KEGG   Rattus norvegicus (rat): 25693
Entry
25693             CDS       T01003                                 

Symbol
Slc18a1
Name
(RefSeq) chromaffin granule amine transporter
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    25693 (Slc18a1)
   04726 Serotonergic synapse
    25693 (Slc18a1)
   04721 Synaptic vesicle cycle
    25693 (Slc18a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25693 (Slc18a1)
  09165 Substance dependence
   05030 Cocaine addiction
    25693 (Slc18a1)
   05031 Amphetamine addiction
    25693 (Slc18a1)
   05034 Alcoholism
    25693 (Slc18a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25693 (Slc18a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   25693 (Slc18a1)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    25693 (Slc18a1)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 25693
NCBI-ProteinID: NP_037284
RGD: 3693
Ensembl: ENSRNOG00000011992
UniProt: Q01818 F1LSA7
Position
16
AA seq 521 aa
MLQVVLGAPQRLLKEGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDSNSS
LHRGPSVSSQQALTSPAFSTIFSFFDNTTTTVEEHVPFRVTWTNGTIPPPVTEATSVPKN
NCLQGIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLM
FAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVG
APFGSVMYEFVGKSSPFLILAFLALLDGALQLCILWPSKVSPESAMGTPLLTLLKDPYIL
VAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKM
GRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHT
SVYGSVYAIADVAFCVGFAIGPSTGGVIVQVIGFPWLMVIIGTINIIYAPLCCFLQNPPA
KEEKRAILSQECPTETQMYTVQKPTKEFPLGENSDDPSSGE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgctccaggttgttctgggtgctcctcagcggttgctgaaggaaggaaggcagtcccgc
aagctggtgctggtggtggtgttcgtggctctgcttctggacaacatgctgctcactgtg
gtggtgcccattgtgcccaccttcctgtacgcgacagagttcaaagacagcaactcttct
ctgcataggggtccttctgtaagctcccagcaagctctcacctctcctgccttctctacc
atattctccttctttgacaacaccaccacaactgtagaagaacatgtacccttccgtgta
acttggacaaatggcaccatccctcctccagtcactgaagccacctcagtaccaaaaaac
aactgcttgcaagggatagagttcttagaagaagaaaacgttcggattgggattctattt
gcttcaaaagctttgatgcaacttctggtcaacccatttgtaggacctcttactaacagg
attggctatcacatccccatgtttgttggctttatgatcatgtttctctccacactaatg
tttgctttctctggcacctatgccctgctatttgtggcccgaactctccaaggcattgga
tcttcgttttcatctgttgcaggacttgggatgctggccagtgtctatactgacaactat
gagagagggagagccatgggaattgctttggggggcctggctttgggacttctggtggga
gcacctttcggaagtgtgatgtatgaatttgtgggcaagtcctcaccattcctcatcttg
gccttcttggcacttctggatggagctctccaactttgcatcctgtggccttcgaaagtg
tctcctgagagtgccatggggactccgcttttgacgcttctcaaagacccttacatcctg
gtagcagcaggttccatctgcttggccaacatgggtgtcgccatactagagcccacgctg
cccatctggatgatgcagaccatgtgctcccccgagtggcagctaggtctggctttcttg
cctgctagtgtggcctacctcattggcacgaacctctttggtgtgttggctaacaagatg
ggtcggtggctgtgctcccttgttgggatggtggcagtaggtatcagcttgctctgtgta
cctctggctcacaatatttttggtcttattggccccaatgcaggccttggctttgccata
ggaatggtggattcctctctgatgcccatcatgggatacctggtggacttacgccacacc
tctgtgtatgggagtgtctatgccatcgccgatgtggccttttgtgtgggctttgctatt
ggcccatctactgggggtgttatcgtacaggtcattggctttccttggctcatggtcatc
attggtaccatcaacatcatttatgctcctctctgctgcttcctgcagaacccgccagct
aaggaggagaagcgtgcaattctgagccaggaatgccccacagagacccagatgtacaca
gtccagaagcccacaaaggagtttccactaggagagaacagcgatgatcctagcagcggg
gagtaa

DBGET integrated database retrieval system