KEGG   Rattus norvegicus (rat): 25696Help
Entry
25696             CDS       T01003                                 

Gene name
Vldlr
Definition
(RefSeq) very low density lipoprotein receptor
  KO
K20053  very low-density lipoprotein receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25696 (Vldlr)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    25696 (Vldlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition EGF_CA cEGF SGL EGF hEGF
Motif
Other DBs
NCBI-GeneID: 25696
NCBI-ProteinID: NP_037287
RGD: 3963
Ensembl: ENSRNOG00000027491
UniProt: F1LPV2
Position
1q52
AA seq 873 aa AA seqDB search
MGTSARWALWLLLALCWAPRDSGATASGKKAKCDSSQFQCTNGRCITLLWKCDGDEDCTD
GSDEKNCVKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPESWRCDGENDCDNGEDEENCGNITCSADEFTCSSGRCVSRNFVCNGQDDCD
DGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
TSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDITKVCDQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQ
WPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIIYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQINDHSPKYTCSCPNGYNLEENGRECQSTSTPVTYSETKDVNTTDILRTSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgtccgcgcgttgggcgctgtggctgctgctcgcgctgtgctgggcgccccgg
gacagcggcgccactgcaagcgggaagaaagccaaatgtgacagctcccaattccagtgc
acaaatggtcgctgcattactctgctgtggaaatgtgatggagacgaagactgtactgat
ggcagtgacgagaagaactgtgtgaagaagacatgtgctgagtcagacttcgtgtgcaaa
aacggccagtgtgttcccaacagatggcagtgtgatggggaccctgattgtgaagatggt
tctgatgaaagcccagaacagtgccatatgagaacatgccgcataaatgaaatcagctgt
ggcgcccgttctactcagtgtatcccagagtcctggagatgcgatggtgaaaatgattgt
gacaatggagaagatgaagaaaactgtggcaacattacatgtagcgcggatgagttcact
tgctccagtggccgctgtgtctccaggaactttgtgtgcaatggacaggatgactgtgac
gatggcagtgatgagctggactgtgctccaccgacctgcggtgcccacgagttccagtgc
agcacctcctcctgcatcccgctcagctgggtgtgtgacgatgacgcagactgttccgac
caatcagacgagtctcttgagcagtgtggccgtcagcctgtgatacacaccaaatgtccc
accagtgagatccagtgtggctctggcgagtgcattcacaaaaaatggcggtgtgacgga
gacccggactgcaaggacggcagcgacgaggtcaactgtccttctcgaacctgcagacct
gaccagtttgaatgtgaggacggtagctgtatccatggcagcagacaatgcaacggcatc
cgagactgtgttgacggctctgatgaagtcaactgcaaaaacgtcaatcagtgcctgggc
cctggaaagtttaagtgcagaagtggggaatgcatagacatcaccaaagtatgtgaccag
gaacaggactgcagagactggagcgacgagcccctgaaggagtgccatatcaacgaatgc
ttggtcaataacggtggctgttcccatatctgcaaagacctagttataggttatgaatgt
gactgtgcagctgggtttgaactgatagacaggaaaacctgtggagatattgatgaatgc
caaaatccggggatctgcagtcaaatttgtatcaacttaaaaggcggttacaaatgtgaa
tgtagtcgtggctatcaaatggatcttgccactggcgtgtgcaaggcagtaggcaaagag
ccaagtctgatcttcactaatcggagagacatcaggaagattggactagagaggaaggaa
tacatccaacttgtagaacaactaagaaacacggtggctctcgatgctgacattgcagct
cagaagctattttgggctgatctaagccaaaaggccatcttcagtgcctcaattgatgac
aaggttggtagacattttaaaatgatcgacaatgtctataatcctgcagccattgctgtt
gattgggtgtacaagaccatctactggactgatgcggcttctaagactatttcagtagct
actctagacggaaccaagaggaagttcctgtttaactctgatttgcgagagcctgcctcc
atagctgtggatccgttgtctggctttgtttactggtcagactggggtgagccagctaaa
atagaaaaagcaggaatgaatggatttgatagacgtccactggtgacagaggacatccaa
tggcctaatggaattaccctcgaccttgtcaaaagccgcctctactggctggattccaag
ttgcacatgctctctagtgtggacctgaatggtcaagatcgtaggatagtgctcaagtct
ctggagttcctagctcatcctcttgcactcaccatatttgaggatcgtgtctactggata
gatggagaaaatgaagcagtgtatggtgccaataaattcactgggtcagagctggccact
ctagtgaacaatctcaatgatgcccaagacatcattatctaccatgaactcgtccagcct
tcaggtaaaaactggtgtgaggaagatatggagaatggaggatgtgaatatctctgcctg
ccagcaccacagatcaatgatcactctccaaaatatacctgttcctgtcccaatgggtac
aatcttgaagaaaatggacgcgagtgtcaaagtacttcaactcctgtgacttacagtgag
acaaaagatgtcaacacaacagacatcctacgaactagtggacttgttcctggagggatc
aatgtgaccacagcagtatcagaagtcagtgttcccccaaaagggacttcagctgcctgg
gccatccttcctctcttgctcttagtgatggcagcagtaggtggctacttgatgtggagg
aattggcaacataaaaacatgaaaagcatgaactttgacaatcccgtgtacttgaagacc
actgaagaggacctctcaatagacattggtagacatagcgcttctgtaggacacacatac
ccagcaatctcagttgtaagcacagatgatgatttggcttga

DBGET integrated database retrieval system