KEGG   Rattus norvegicus (rat): 25697Help
Entry
25697             CDS       T01003                                 

Gene name
Ctsl, CATHL, CatL, Ctsl1
Definition
(RefSeq) cathepsin L
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05205  Proteoglycans in cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25697 (Ctsl)
   04142 Lysosome
    25697 (Ctsl)
   04140 Autophagy - animal
    25697 (Ctsl)
  09143 Cell growth and death
   04210 Apoptosis
    25697 (Ctsl)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25697 (Ctsl)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25697 (Ctsl)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25697 (Ctsl)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25697 (Ctsl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25697 (Ctsl)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25697 (Ctsl)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25697 (Ctsl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     25697 (Ctsl)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25697 (Ctsl)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   25697 (Ctsl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25697 (Ctsl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 25697
NCBI-ProteinID: NP_037288
RGD: 2448
Ensembl: ENSRNOG00000018566
UniProt: P07154
Position
17p14
AA seq 334 aa AA seqDB search
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQ
LHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKPVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKN
SWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttactcctcctggctgtcctctgcttgggaacagccttagccactccaaaa
tttgatcaaacgtttaatgcacagtggcaccagtggaagtccacacacagaagactgtat
ggcacgaatgaggaagagtggaggagagcagtgtgggagaagaacatgaggatgatccag
ctacacaatggggagtacagcaacgggaagcacggctttaccatggagatgaacgccttc
ggtgacatgaccaatgaggaattcaggcagatagtgaatggctatcgccaccagaagcac
aagaagggaaggttatttcaggaacctctgatgctgcagatccccaagactgtggactgg
agagaaaagggttgtgtgactcctgtgaagaatcagggccagtgtggttcttgctgggct
tttagcgcatcgggttgcctagaaggacagatgttccttaagactggcaaactgatctca
ctgagtgaacagaaccttgtggactgttctcacgatcaaggcaatcagggctgtaatgga
ggcctgatggattttgctttccagtacattaaggaaaatggaggtctggactcagaggag
tcttatccctatgaagcaaaggatggatcttgtaaatacagagctgagtatgctgtggct
aacgacacagggtttgtggatatccctcagcaagagaaagccctcatgaagcctgtagcg
acggtggggcctatttctgttgccatggatgcaagccatccgtctctccagttctatagt
tcaggtatctactatgaacccaactgtagcagcaaggacctcgaccatggggttctggtg
gttggctatggttatgaaggaacagattcaaataaggataaatactggcttgtcaaaaac
agctggggtaaagaatggggtatggatggctacatcaaaatagccaaagaccggaacaac
cactgcggacttgccaccgcagccagctatcctatcgtgaattga

DBGET integrated database retrieval system