KEGG   Rattus norvegicus (rat): 25697
Entry
25697             CDS       T01003                                 

Gene name
Ctsl
Definition
(RefSeq) procathepsin L preproprotein
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05205  Proteoglycans in cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    25697 (Ctsl)
   04142 Lysosome
    25697 (Ctsl)
   04140 Autophagy - animal
    25697 (Ctsl)
  09143 Cell growth and death
   04210 Apoptosis
    25697 (Ctsl)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25697 (Ctsl)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25697 (Ctsl)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25697 (Ctsl)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25697 (Ctsl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25697 (Ctsl)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25697 (Ctsl)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25697 (Ctsl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     25697 (Ctsl)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25697 (Ctsl)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   25697 (Ctsl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25697 (Ctsl)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 25697
NCBI-ProteinID: NP_037288
RGD: 2448
Ensembl: ENSRNOG00000018566
UniProt: P07154
Position
17
AA seq 334 aa
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQ
LHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKPVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKN
SWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacccctttactcctcctggctgtcctctgcttgggaacagccttagccactccaaaa
tttgatcaaacgtttaatgcacagtggcaccagtggaagtccacacacagaagactgtat
ggcacgaatgaggaagagtggaggagagcagtgtgggagaagaacatgaggatgatccag
ctacacaatggggagtacagcaacgggaagcacggctttaccatggagatgaacgccttc
ggtgacatgaccaatgaggaattcaggcagatagtgaatggctatcgccaccagaagcac
aagaagggaaggttatttcaggaacctctgatgctgcagatccccaagactgtggactgg
agagaaaagggttgtgtgactcctgtgaagaatcagggccagtgtggttcttgctgggct
tttagcgcatcgggttgcctagaaggacagatgttccttaagactggcaaactgatctca
ctgagtgaacagaaccttgtggactgttctcacgatcaaggcaatcagggctgtaatgga
ggcctgatggattttgctttccagtacattaaggaaaatggaggtctggactcagaggag
tcttatccctatgaagcaaaggatggatcttgtaaatacagagctgagtatgctgtggct
aacgacacagggtttgtggatatccctcagcaagagaaagccctcatgaagcctgtagcg
acggtggggcctatttctgttgccatggatgcaagccatccgtctctccagttctatagt
tcaggtatctactatgaacccaactgtagcagcaaggacctcgaccatggggttctggtg
gttggctatggttatgaaggaacagattcaaataaggataaatactggcttgtcaaaaac
agctggggtaaagaatggggtatggatggctacatcaaaatagccaaagaccggaacaac
cactgcggacttgccaccgcagccagctatcctatcgtgaattga

KEGG   Rattus norvegicus (rat): 50654
Entry
50654             CDS       T01003                                 

Gene name
Ctss
Definition
(RefSeq) cathepsin S preproprotein
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04145  Phagosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50654 (Ctss)
   04142 Lysosome
    50654 (Ctss)
  09143 Cell growth and death
   04210 Apoptosis
    50654 (Ctss)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    50654 (Ctss)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    50654 (Ctss)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    50654 (Ctss)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    50654 (Ctss)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     50654 (Ctss)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   50654 (Ctss)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   50654 (Ctss)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 50654
NCBI-ProteinID: NP_059016
RGD: 621513
UniProt: Q02765
Position
2
AA seq 330 aa
MAVLGAPGVLCDNGATAERPTLDHHWDLWKKTRMRRNTDQNEEDVRRLIWEKNLKFIMLH
NLEHSMGMHSYSVGMNHMGDMTPEEVIGYMGSLRIPRPWNRSGTLKSSSNQTLPDSVDWR
EKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCG
GGFMTEAFQYIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAV
ATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWG
LHFGDQGYIRMARNNKNHCGIASYCSYPEI
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctgttttgggtgcccctggtgtgctctgtgacaatggagcaactgcagagagacct
accctggaccaccactgggatctctggaagaaaactcgcatgagaaggaatacagatcag
aatgaagaagacgtacgacgtctcatctgggaaaagaatctcaagtttataatgcttcac
aatctggaacattctatgggaatgcattcatacagtgtgggcatgaaccacatgggagac
atgacacctgaagaagtcataggttatatgggctctctgagaattcccaggccctggaat
agaagtggcactctcaagtcaagctctaatcagacattgcccgactctgtggactggcga
gaaaagggctgcgtcactaatgtgaaataccagggctcttgtggttcctgctgggctttc
agcgccgagggggcccttgaagggcagctgaagctgaaaacggggaagctggtgtctctc
agtgctcagaacctggtggattgctcaaccgaagaaaagtacgggaataaaggctgcggg
ggtggcttcatgaccgaagctttccagtacatcatcgatacgagcatcgactcagaagct
tcctatccctacaaagccatggatgaaaagtgtctctatgacccaaaaaatcgagctgcc
acgtgttcaaggtacattgagctccccttcggcgatgaagaagctctgaaagaagcagtg
gccactaaagggcctgtctctgtgggcatcgacgacgccagccattcctccttcttcctc
taccaaagtggtgtctatgatgacccctcctgtaccgagaatatgaatcatggtgttctc
gtggttggctatgggactcttgatgggaaagactactggcttgtgaaaaacagttggggc
cttcactttggtgatcaaggatatattcggatggcgagaaataacaaaaatcactgcggg
attgctagctattgctcttacccagaaatctaa

KEGG   Rattus norvegicus (rat): 64529
Entry
64529             CDS       T01003                                 

Gene name
Ctsb
Definition
(RefSeq) cathepsin B preproprotein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04142  Lysosome
rno04210  Apoptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    64529 (Ctsb)
   04140 Autophagy - animal
    64529 (Ctsb)
  09143 Cell growth and death
   04210 Apoptosis
    64529 (Ctsb)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64529 (Ctsb)
   04612 Antigen processing and presentation
    64529 (Ctsb)
  09152 Endocrine system
   04924 Renin secretion
    64529 (Ctsb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64529 (Ctsb)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    64529 (Ctsb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64529 (Ctsb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64529 (Ctsb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     64529 (Ctsb)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   64529 (Ctsb)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   64529 (Ctsb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   64529 (Ctsb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   64529 (Ctsb)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1
Other DBs
NCBI-GeneID: 64529
NCBI-ProteinID: NP_072119
RGD: 621509
Ensembl: ENSRNOG00000010331
UniProt: Q6IN22
Structure
PDB: 
1THE 1CTE 1CPJ 1MIR

Position
15
AA seq 339 aa
MWWSLIPLSCLLALTSAHDKPSFHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDR
ICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCL
PYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSW
NVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtggtggtccttgatccctctctcttgcctgctggcactgaccagtgcccatgacaag
ccttcctttcacccactgtcggacgacatgattaactatatcaacaaacagaatacaaca
tggcaggctggacgcaacttctacaatgttgacataagctatctgaagaagctgtgtgga
actgtcctgggtggacccaagctgccggaaagggttgggttcagcgaggacataaatcta
cctgaatcctttgatgcacgggaacagtggtccaattgcccgaccatcgcacagatcaga
gaccaggggtcctgtggctcttgttgggcatttggggcagtggaagccatgtctgaccga
atctgcattcacaccaatggccgagtcaatgtggaggtgtctgctgaggacctgcttacc
tgctgtggtatccagtgtggggatggctgtaatggtggctatccctctggagcatggaac
ttctggactagaaaaggcctggtttctggtggagtatacaattctcatataggctgctta
ccctacaccatccctccctgtgaacaccatgtcaatggctcccgtcccccatgcactgga
gaaggagatactcccaagtgcaacaagatgtgtgaggctggctactccacatcctacaag
gaagataagcactatgggtacacttcctacagtgtgtctgacagcgagaaggagatcatg
gcggaaatctacaaaaatggcccagtggagggtgcttttactgtgttttctgacttcttg
acttacaaatcaggcgtatacaagcatgaagccggtgatgtgatgggaggccatgccatc
cgcattctgggctggggaatagagaatggagtaccctactggctggtagcaaactcctgg
aacgttgactggggtgataatggtttctttaaaatcctcagaggagagaaccactgtgga
attgaatcagaaatcgtggctggaatcccacgcactcagcagtactggggaagattctaa

DBGET integrated database retrieval system