KEGG   Rattus norvegicus (rat): 25702
Entry
25702             CDS       T01003                                 

Gene name
Pnlip, PANLI
Definition
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno04972  Pancreatic secretion
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
Module
rno_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    25702 (Pnlip)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    25702 (Pnlip)
   04975 Fat digestion and absorption
    25702 (Pnlip)
   04977 Vitamin digestion and absorption
    25702 (Pnlip)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     25702 (Pnlip)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Palm_thioest Gti1_Pac2 Hydrolase_4 DUF900
Other DBs
NCBI-GeneID: 25702
NCBI-ProteinID: NP_037293
RGD: 3360
Ensembl: ENSRNOG00000017725
UniProt: P27657
Position
1q55
AA seq 465 aa
MLMLWTFAVLLGAVAGKEVCFDKLGCFSDDAPWSGTIDRPLKALPWSPAQINTRFLLYTN
ENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKVESVNCIC
VDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGHPPDNVHLIGHSLGSHVAGEAGK
RTFGAIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGH
LDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGF
SCSSYNVFSANKCFPCGSEGCPQMGHYADKYPGKTKELYQKFYLNTGDKSNFARWRYQVT
VTLSGQKVTGHILVSLFGNGGNSKQYEVFKGSLHPGDTHVKEFDSDMDVGDLQKVKFIWY
NNVINPTLPKVGASRISVERNDGRVFNFCSQDTVREDVLLTLSAC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctgatgctgtggacatttgcagtgctgctgggagcagtagctggaaaagaagtttgc
tttgacaaactcggctgcttcagtgatgatgccccgtggtcaggaaccatagacagaccc
ctgaaagcactgccctggagcccagcacagatcaacacccgctttctcctctacaccaac
gagaaccaagacaactaccagaaaattacttcagatgcatcgagtatcagaaactccaat
ttcaaaacgaacagaaaaacccgcatcattatccacggcttcattgacaagggagaggag
aactggctatctgacatgtgcaagaacatgttcaaagtggagagtgtgaactgcatctgt
gtggactggaaaggtggctcccgggctacatacacccaggctacccagaacgtccgggtc
gtgggtgcagaagtggcattattggttaacgttctgaagtctgacctcggtcatccacct
gacaacgtccacctgattggccacagcctgggttcccacgttgctggggaggcaggaaag
aggacattcggagctattgggaggatcacagggttggacgcggctgaaccttacttccag
ggcacacctgaagaagtccgtctggaccccaccgatgcccagtttgtggatgcaattcac
acagatgctgcacccatcatccccaacttaggatttggaatgagccagactgtgggtcac
ctagatttctttcctaatggagggatggaaatgcctggatgtcagaagaatatcctttcc
caaatcgttgacatcgacgggatctgggaaggaactcgcgactttgctgcctgtaaccac
ttgagaagctacaaatattacaccgacagtatcgtcaacccgactggcttctctggcttc
tcctgtagctcttacaatgttttttctgcaaataagtgcttcccatgtgggagtgaagga
tgcccacagatgggtcactatgctgacaaataccctgggaagacaaaagaactctaccag
aaattttacctgaacactggtgacaagagcaacttcgcacgttggcggtaccaggtgact
gtcaccctctctggacagaaggtcactgggcacattctagtttctttgtttggaaatgga
ggaaactctaaacagtatgaagttttcaagggctctctgcatccaggtgacactcatgtc
aaggaatttgactctgatatggatgttggagatttgcagaaagttaaatttatttggtac
aacaatgtgatcaacccaactctacccaaagtgggagcatcaaggatttcagtggaacga
aatgacggcagagtgttcaacttctgtagtcaagatacagtgagggaggatgtcctgctt
acactgtctgcatgttag

DBGET integrated database retrieval system