KEGG   Rattus norvegicus (rat): 25707Help
Entry
25707             CDS       T01003                                 

Gene name
Cntf
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25707 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25707 (Cntf)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   25707 (Cntf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNTF Neurexophilin
Motif
Other DBs
NCBI-GeneID: 25707
NCBI-ProteinID: NP_037298
RGD: 2370
Ensembl: ENSRNOG00000012460
UniProt: P20294
Position
1q43
AA seq 200 aa AA seqDB search
MAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVAS
TDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFA
YQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQMGISALESHYGAKDKQM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgcagagcaaacacctctgacccttcaccgccgggacctctgtagccgttct
atctggctagcaaggaagattcgttcagacctgactgctcttatggaatcttatgtaaaa
catcagggcctgaataaaaatatcaaccttgactcagtggatggtgtaccagtggcaagc
actgatcgttggagtgagatgactgaggcagagcgactccaagagaacctccaggcttac
cgtaccttccaagggatgttaaccaagctcttagaagaccagagagtacatttcacccca
actgaaggtgacttccatcaggcaatacatactcttatgctccaagtttctgcctttgcc
taccagctagaggagttaatggtgcttctggaacagaagatccctgaaaatgaggctgat
gggatgcctgccacagttggagatggtggtctctttgagaagaagctatggggcttgaag
gtccttcaagagctctcacagtggactgtgaggtctatccatgaccttcgtgtcatttct
tctcatcagatgggaatctcagcacttgagagccattatggggccaaagataagcagatg
tag

DBGET integrated database retrieval system