KEGG   Rattus norvegicus (rat): 25712
Entry
25712             CDS       T01003                                 

Gene name
Ifng
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno04060  Cytokine-cytokine receptor interaction
rno04066  HIF-1 signaling pathway
rno04217  Necroptosis
rno04350  TGF-beta signaling pathway
rno04380  Osteoclast differentiation
rno04612  Antigen processing and presentation
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    25712 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25712 (Ifng)
   04630 JAK-STAT signaling pathway
    25712 (Ifng)
   04066 HIF-1 signaling pathway
    25712 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25712 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25712 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25712 (Ifng)
   04612 Antigen processing and presentation
    25712 (Ifng)
   04660 T cell receptor signaling pathway
    25712 (Ifng)
   04658 Th1 and Th2 cell differentiation
    25712 (Ifng)
   04659 Th17 cell differentiation
    25712 (Ifng)
   04657 IL-17 signaling pathway
    25712 (Ifng)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25712 (Ifng)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25712 (Ifng)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25712 (Ifng)
  09172 Infectious disease: viral
   05160 Hepatitis C
    25712 (Ifng)
   05164 Influenza A
    25712 (Ifng)
   05168 Herpes simplex virus 1 infection
    25712 (Ifng)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25712 (Ifng)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25712 (Ifng)
   05144 Malaria
    25712 (Ifng)
   05145 Toxoplasmosis
    25712 (Ifng)
   05140 Leishmaniasis
    25712 (Ifng)
   05142 Chagas disease
    25712 (Ifng)
   05143 African trypanosomiasis
    25712 (Ifng)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    25712 (Ifng)
   05323 Rheumatoid arthritis
    25712 (Ifng)
   05321 Inflammatory bowel disease
    25712 (Ifng)
   05330 Allograft rejection
    25712 (Ifng)
   05332 Graft-versus-host disease
    25712 (Ifng)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25712 (Ifng)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    25712 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    25712 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25712 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25712 (Ifng)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    25712 (Ifng)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   25712 (Ifng)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   25712 (Ifng)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 25712
NCBI-ProteinID: NP_620235
RGD: 2866
Ensembl: ENSRNOG00000007468
UniProt: P01581
Position
7
AA seq 156 aa
MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQK
DGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKF
EVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
NT seq 471 nt   +upstreamnt  +downstreamnt
atgagtgctacacgccgcgtcttggttttgcagctctgcctcatggccctctctggctgt
tactgccaaggcacactcattgaaagcctagaaagtctgaagaactattttaactcaagt
agcatggatgctatggaaggaaagagcctcctcttggatatctggaggaactggcaaaag
gacggtaacacgaaaatacttgagagccagattatctctttctacctcagactctttgaa
gtcttgaaagacaaccaggccatcagcaacaacataagtgtcatcgaatcgcacctgatc
actaacttcttcagcaacagtaaagcaaaaaaggatgcattcatgagcatcgccaagttc
gaggtgaacaacccacagatccagcacaaagctgtcaatgaactcatcagagtgattcac
cagctgtcaccagaatctagcctaaggaagcggaaaaggagtcggtgctga

DBGET integrated database retrieval system