KEGG   Rattus norvegicus (rat): 25714
Entry
25714             CDS       T01003                                 

Gene name
Myf6, MRF4AA
Definition
(RefSeq) myogenic factor 6
  KO
K18485  myogenic factor 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25714 (Myf6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    25714 (Myf6)
SSDB
Motif
Pfam: Basic HLH Myf5
Other DBs
NCBI-GeneID: 25714
NCBI-ProteinID: NP_037304
RGD: 3134
Ensembl: ENSRNOG00000004878
UniProt: P19335
Position
7q21
AA seq 242 aa
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFL
RTCSPQWPSVSDHSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVV
EK
NT seq 729 nt   +upstreamnt  +downstreamnt
atgatgatggacctttttgaaactggctcctatttcttctacttagatggagaaaatgtg
actcttcagccattagaagtggcagagggctctcctttgtacccagggagtgatggtacc
ctatccccttgccaggaccaaatgccccaggaagccgggagcgacagcagtggagaggaa
cacgttctggctcccccaggccttcagccaccccactgcccaggtcagtgtctgatctgg
gcttgcaagacttgcaagagaaaatctgcccccacagatcgtcggaaagcagctaccctg
cgcgaaaggaggaggcttaagaaaatcaacgaagcctttgaggccttgaagcgtagaact
gtggccaaccccaaccagaggctgcccaaggtggagattctgagaagtgccatcaactac
attgagcgtctgcaggacctgctgcaccggctggatcagcaagagaaaatgcaggagctg
ggggtggacccttacagctacaaacccaagcaagaaattcttgagggtgcggatttcctg
cgcacctgcagcccgcagtggccaagtgtttcggatcattccaggggcctggtgataact
gctaaggaaggaggagcaagcgtcgatgcttcagcctccagcagtcttcagcgcctttct
tccatcgtggacagtatttcctcagaggaacgcaaactccccagcgtggaggaggtggtg
gagaagtaa

DBGET integrated database retrieval system