KEGG   Rattus norvegicus (rat): 25715
Entry
25715             CDS       T01003                                 

Gene name
Slc11a2
Definition
(RefSeq) natural resistance-associated macrophage protein 2
  KO
K21398  natural resistance-associated macrophage protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04216  Ferroptosis
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25715 (Slc11a2)
  09143 Cell growth and death
   04216 Ferroptosis
    25715 (Slc11a2)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    25715 (Slc11a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25715 (Slc11a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC11: Proton-coupled metal ion transporter
   25715 (Slc11a2)
SSDB
Motif
Pfam: Nramp
Other DBs
NCBI-GeneID: 25715
NCBI-ProteinID: NP_037305
RGD: 3684
Ensembl: ENSRNOG00000019550
UniProt: O54902 A0A140TAD8
Position
7
AA seq 592 aa
MGKKQPRAAASAAPNCELKSYSKSTDPQVSTMVLDPEEKIPDDGASGDHGDSASLGAINP
AYSNSSLPHSTGDSEEPFTTYFDEKIPIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGN
IESDLQSGAVAGFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIIL
WLMVELAIIGSDMQEVIGSAIAINLLSAGRVPLYGGVLITIADTFVFLFLDKYGLRKLEA
FFGFLITIMALTFGYEYVTVKPSQSQVLRGMFVPSCSGCHTPQVEQAVGIVGAVIMPHNM
YLHSALVKSRQVNRANKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFEKTNEQ
VVEVCRNSSSPHADLFPNDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMT
GTYSGQFVMEGFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQ
LPFALIPILTFTSLRPVMSEFSNGIGWRIAGGILVLLVCSINMYFVVVYVQELGHVALYV
VAAVVSVAYLGFVFYLGWQCLIALGLSFLDCGRSVSISKVLLSEDTSGGNTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggggaagaagcagccgagggcagcagcaagtgctgctccaaactgtgagctaaaatcc
tattctaagagcacagatcctcaggtatctaccatggtgttggatcctgaagaaaagatt
ccagacgatggtgcttctggggaccatggagactcggccagcctcggtgccatcaaccct
gcttacagcaactcttccctcccacattccaccggggattctgaggagcccttcaccacc
tactttgatgagaaaatccccattcctgaggaggagtactcttgttttagtttccgtaaa
ctctgggccttcacaggacctggttttcttatgagcattgcctacctggatccaggaaac
attgaatctgatttacagtctggagcagtggctggatttaagttgctctgggtgctcctg
ctggccactattgtggggctgctgctccagcgtctcgcagctcgactgggagtggtcacc
ggcttgcaccttgctgaagtgtgtcaccgtcagtatcccaaggtcccacggatcatcctg
tggctaatggtggagttggcaatcattggttctgatatgcaggaagtcattggctcagcc
atcgccatcaatctcctgtctgccggaagggttcccctgtatggtggagtcctcatcacc
atcgcagatacttttgtatttctctttttggacaaatatggcttgcggaagctggaagca
ttttttggctttctcatcactatcatggccctcacatttggatatgagtatgttacagtg
aaacccagccaaagccaagtactcaggggcatgttcgtgccatcctgttcaggctgccac
acccctcaggtggagcaggcggtgggcatcgtgggagctgtgatcatgccacacaacatg
tacctgcactctgccttagtcaagtctagacaagtgaaccgggccaataagcaggaagtt
cgagaagccaataagtacttcttcatcgagtcctgcattgcactctttgtttccttcatc
atcaatgtctttgtcgtctccgtctttgctgaagcattttttgagaaaaccaatgagcag
gtggttgaggtctgcagaaatagcagcagcccccatgctgacctctttcctaacgacaac
tctaccctggctgtggacatctacaaagggggtgttgtgcttggatgttacttcgggcct
gcggccctctacatctgggcggtggggatcctggctgctggacagagctccaccatgact
ggaacctattctggccagtttgtcatggagggattcctgaacctaaaatggtcgcgcttt
gcccgcgtgatcctgaccaggtctattgccatcatccctaccctgcttgttgctgtcttc
caagatgtggagcatctgacagggatgaatgatttcctgaatgttctgcagagcctacag
ctcccctttgccctcatccctatcctcaccttcacaagcctgcggccagtgatgagtgag
ttctccaacggaataggctggaggatcgcaggcggcatcttggtccttctcgtctgctcc
atcaacatgtactttgtcgtggtctacgtccaggagctagggcatgtggcactgtatgtg
gtggctgcagtggttagcgtggcttatctgggctttgtgttctacttgggttggcagtgt
ttgattgcgttgggcctgtcgttcctggactgtgggcgctcggtaagcatctctaaagtc
ctgctgagcgaagataccagcggtggcaatactaagtaa

KEGG   Rattus norvegicus (rat): 316519
Entry
316519            CDS       T01003                                 

Gene name
Slc11a1
Definition
(RefSeq) natural resistance-associated macrophage protein 1
  KO
K12347  natural resistance-associated macrophage protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    316519 (Slc11a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    316519 (Slc11a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC11: Proton-coupled metal ion transporter
   316519 (Slc11a1)
SSDB
Motif
Pfam: Nramp
Other DBs
NCBI-GeneID: 316519
NCBI-ProteinID: NP_001026828
RGD: 1601463
Ensembl: ENSRNOG00000014956
Vega: OTTRNOG00000001510
UniProt: P70553
Position
9
AA seq 507 aa
MIRDKNPQRVNRPSYGSISSLPSPAPQPEPSRNTYLSEKIPIPSTEQLLWVLLWATVLGL
LCQRLAARLGVVTGKDLGEICHLYYPKVPRILLWLTIELAIVGSDMQEVIGTAISFNLLS
AGRIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGFLVTIMALTFGYEYVVARPSQGAL
LKGLFLPSCPGCGQPELLQAVGIVGAIIMPHNIYLHSALVKSREVDRTRRGDVREANMYF
LTEATIALFVSFIINLFVMAVFGQAFYQQTNEEAFNICANSSLHNYAKIFPRDNNTVSVD
IYQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLT
RSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVMQEFANGWL
SKVITSCIMALVCAINLYFVISYLPSLPHPAYFGLVALLAIGYLGLTAYLAWTCCIAHGA
KFLTHSSHQRFLYGLPIEEQEGREGSG
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgattcgtgacaaaaacccccagagggtgaacaggcccagttatggctccatttccagc
ctgcctagcccagcacctcagccagagccttccaggaacacctacctgagtgagaagatt
cccatccccagcacggaacagctgctctgggtgctgctctgggccactgtgctaggcttg
ctctgccagcggctggctgcccggctgggcgtggtgacaggcaaggatctgggtgaaatc
tgccatctctactaccctaaggtgccccgcatcctcctctggctgaccattgagctggcc
attgtgggctcagacatgcaggaagtcatcggaacggctatctccttcaatctgctctcc
gctggacgcatccccctgtggggtggcgtactgatcactattgtggataccttcttcttc
ctcttcctggataactatggtttgcgcaagttggaagcgttttttgggttcctcgttacc
ataatggctttgaccttcggttatgagtatgtggtggctcgtccatctcagggagccctt
cttaagggcctgttcctgccctcctgcccgggctgtgggcagcctgagctgctgcaggca
gtgggcatcgttggtgccatcatcatgcctcataacatctacctgcactcggccttggtc
aagtctagagaggtagacagaactcgccggggggatgttcgagaagccaacatgtacttc
ctgactgaggccaccatcgccctcttcgtgtcattcatcatcaacctcttcgtcatggct
gtttttggtcaggccttctaccagcaaaccaatgaggaagcgttcaacatctgtgccaac
agcagcctccacaactatgctaagatcttccccagggacaataacacagtgtcagtggat
atttatcaaggaggtgtgatcctaggctgtctctttggccctgcggccctctacatctgg
gcagtaggtctcctggcagcgggtcagagttctactatgaccggcacctatgcaggacaa
ttcgtgatggagggtttccttaagctgcgatggtctcgatttgcacgcgtccttctcact
cgctcttgcgctatcctgcccactgtgctggtggctgtcttccgagacctgagggacctg
tccggcctcaacgatctactcaatgttctgcagagtctactgctgccctttgctgtgctg
cccattctgactttcaccagcatgccagccgtcatgcaggagtttgccaatggctggttg
agcaaagtcattacttcctgcatcatggcactggtctgcgccatcaacctgtacttcgtg
atcagctacctgcccagcctcccgcaccctgcctactttggccttgtggctctgctcgcc
ataggttacttgggccttactgcttatctggcctggacctgttgcattgcccatggagcc
aagtttctgacccacagctcccaccagcgcttcctgtatggactccctatcgaggagcag
gaaggcagggagggttccgggtga

DBGET integrated database retrieval system