KEGG   Rattus norvegicus (rat): 25724Help
Entry
25724             CDS       T01003                                 

Gene name
Itgb4
Definition
(RefSeq) integrin subunit beta 4
  KO
K06525  integrin beta 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25724 (Itgb4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25724 (Itgb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25724 (Itgb4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25724 (Itgb4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    25724 (Itgb4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    25724 (Itgb4)
   05414 Dilated cardiomyopathy (DCM)
    25724 (Itgb4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25724 (Itgb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25724 (Itgb4)
   04515 Cell adhesion molecules [BR:rno04515]
    25724 (Itgb4)
   04090 CD molecules [BR:rno04090]
    25724 (Itgb4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   25724 (Itgb4)
  Exosomal proteins of bladder cancer cells
   25724 (Itgb4)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   25724 (Itgb4)
CD molecules [BR:rno04090]
 Proteins
  25724 (Itgb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail I-EGF_1 PSI_integrin Pur_ac_phosph_N EGF_2 SEA
Motif
Other DBs
NCBI-GeneID: 25724
NCBI-ProteinID: NP_037312
RGD: 2928
Ensembl: ENSRNOG00000005580
UniProt: Q64632
Structure
PDB: 

Position
10q32.1
AA seq 1807 aa AA seqDB search
MAGLCSSPWVKLLLAVVLSAGLPGNMANRCKKAQVKSCTECIRVDKSCAYCTDELFKERR
CNTQADVLAAGCRGESVLVMESSLEITENIQIDTSLHRSQVSPQGLQVRLRPGEERNFVF
KVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWDKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYK
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLE
EAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDG
THVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHC
VCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYD
NFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECG
RCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMV
DELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPSWWLIPLL
IFLLLLLVLLLLLCWKYCACCKACLGLLPCCNQGHMVGFKEDHYMLRENLMASDHLDTPM
LRSGNLKGRDTVRWKITNNVQRPGFATHAASISPTELVPYGLSLRLGRLCTENLMKPGTR
ECDQLRQEVEENLNEVYRQVNGVHKLQQTKFRQQPNAGKKQDHTIVDTVLLAPRSAKQSL
LKLTEKQVEQGSFHELKVAPGYYTLTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEK
QLLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYSVSRGDQVARIPVIRHILD
NGKSQVSYSTQDNTAHGHRDYVPVEGELLFYPGETWKELQVKLLELQEVDSLLRGRQVRR
FQVQLSNPKFGARLGQPNTATVIIGEQDETDRSLINEISASPPLPRGDLGAPQNPNAKAA
GSRKIHFNWLPPPGKPMGYRVKYWVQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCA
YGAHGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYG
LVNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLAT
QPKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMD
FAYPGSANSLHRMTAANVAYGTHLSPHQTHRMLSTSSTLTRDYHSLTRTDHSQSGTLPRD
YSTLTSLSSQGLPPIWEDGRSRLPLSWTLGSWSRAQMKGVPASRGSPDSIILAGQSAAPS
WGTDSRGAMGVPDTPTRLVFSALGPTSLKVSWQEPQCDRALLGYSVEYQLLNGGEMHRLN
IPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAF
TLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGGPARTFRVDGDN
PESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHSGLFQNPL
QSEYSTVTSTHSTTTTEPFLIDGLTLGTQRLEAGGSLTRHVTQEFVSRTLTTSGSLSTHM
DQQFFQT
NT seq 5424 nt NT seq  +upstreamnt  +downstreamnt
atggcagggctatgttccagcccgtgggtgaagctgctactggcagtagtgctgagtgcc
ggtctccctggaaacatggccaaccgctgtaagaaggctcaggtgaagagctgtacggag
tgcatccgagtggacaagagctgtgcctactgcacagacgagctgttcaaggagcgacgc
tgcaacacccaggcggacgttctggctgcaggctgccggggagagagcgtgttggtcatg
gagagcagccttgagatcacagagaacatccagattgacaccagcctgcaccgcagccag
gtatctccccaaggcctgcaagtgcggctgcggccgggtgaggagcgcaactttgtgttc
aaggtgtttgagcccctggagagccccgtggatctgtatatcctcatggacttttccaac
tccatgtctgatgatctggacaacctcaagcagatggggcagaacctggccaagatcctg
cgccagctcaccagtgactacactattggattcggaaagtttgtggacaaagtcagtgtc
cctcagacggacatgaggcccgagaagctgaaggagccgtggcccaacagcgacccccca
ttctccttcaagaatgttatcagcttaacagagaatgtggaagaattctgggacaaactg
caaggagaacgcatctcaggcaacctggacgctcctgaaggaggcttcgacgccatcctg
cagacagccgtgtgcacaagggacattggctggagagcggacagcacccacctgctggtg
ttctccaccgagtctgccttccactatgaggctgatggtgccaacgtgctggccggcatc
atgaaccgcaatgatgagaagtgccacctggatgccacaggcgcctacacccagtataag
acccaggactacccatctgtgcccacactggttcgcctgcttgccaaacacaacattatc
cccatctttgccgtcaccaactactcttacagttactacgagaagctccataaatatttc
cctgtctcctctctgggagtcctgcaggaagattcatccaacatcgtggagctgctggag
gaggctttctatcgaattcgctccaacctggacatccgggctctggacagcccgagaggc
ctgaggacagaggtcacctccgataccctccagaagacagagactgggtcctttcacatc
aagcggggggaagtgggcacatacaatgtgcatcttcgggcagtggaggacatagatggg
acacacgtgtgccagctggccaaagaagaccaaagaggtaacatccacctgaaaccctcc
ttctccgatggcctccggatggacgcgagcgtcatctgtgacatgtgcgcctgcgagctg
caaaaggaagttcagtcagctcgctgtcactacagaggagacttcatgtgtggacactgt
gtgtgcaacgagggctggagtggcaaaacctgcaattgctccacgggttccctgagtgac
acgcagccctgcctgcgtgagggtgaggacaaaccatgctcgggccatggcgagtgccag
tgcggacgttgtgtgtgctacggtgaaggccgctacgagggtcacttctgcgagtatgac
aacttccagtgtccccgcacctctggattcctttgcaatgaccggggacgctgctccatg
ggagagtgtgtgtgtgagcctggttggaccggccgcagctgtgactgtcccctcagcaat
gccacctgtatcgatagcaatgggggcatctgcaatggactaggcttctgtgagtgtggc
cgttgtcactgcaaccagcggtcttcgctctacacggacaccacctgtgagatcaactac
tcggcgatacgcctgggcctctgtgaggacctccgctcctgtgtacagtgccaggcctgg
ggcactggggagaagaaagggcgcacgtgtgaggaatgcaactttaaggtcaagatggta
gacgagcttaagaaagcggaagaggtggtggagtactgctccttccgggacgaggatgac
gactgcacttacagctacaccgtggagggcgacggcagccctgggcccaacagcaccgtc
ctggtccacaagaagaaagactgcctcccggctccttcttggtggctcattcccctgctc
atcttcctcctgttgctcctggtgttgcttctgctgctctgctggaaatactgtgcctgc
tgcaaagcctgcctgggacttcttccttgctgcaaccaaggtcacatggtgggctttaag
gaagatcactatatgctgcgggagaacctgatggcctctgaccacctggacacgcccatg
ctgagaagtgggaacctcaagggacgagacacagtccgctggaagatcaccaacaatgtg
caacggcctggctttgccacccatgctgccagcatcagccccacagagctcgtaccctat
gggctatccctgcgccttggccgcctctgcactgagaacctcatgaagcctggcacccga
gagtgtgaccagctacgccaggaggtggaggaaaatctgaatgaggtatacagacaagtc
aacggcgtacacaagctccagcagacgaagttccgacagcaacccaacgctgggaaaaag
caagaccacaccattgtggacacagtgttgctggcgccccgctctgccaagcagtcgctg
ctgaagctgacagagaagcaggtggagcaggggtccttccatgaactcaaggtggcccct
ggttactacaccctcacagcagagcaggatgcccggggcatggtggagttccaggagggg
gtagagctggtggacgtgcgtgtgcccctcttcatccggcctgaggatgatgatgagaaa
cagctgctggtggaggccattgatgtccccgtgggcactgccacccttggtcgacgcctg
gtaaacatcaccatcattaaggagcaagctagcgggatagtgtcctttgagcagcctgaa
tactcagtgagtcgtggagaccaggtggcccgcatccctgtcatccggcacatcctggac
aacggcaagtcccaggtctcctatagcacacaggataatacagcacatggacaccgggat
tatgtccctgtggaaggggagctgttgttctaccccggagagacctggaaggaactgcag
gtgaagctcctggagctgcaggaagtcgactccctccttcgtggccgccaggtccgacgc
ttccaagttcaactcagcaaccccaagtttggagcccgcctgggccagcccaacacagcc
actgttatcatcggggaacaagatgaaacggacagaagtctcataaatgagatatccgca
tcgccgccactaccccgtggagacctgggtgccccgcagaaccccaatgccaaggctgcc
ggatccaggaagatccatttcaactggctgccccctcctggcaagccaatggggtatagg
gtgaaatactgggtccagggcgactctgagtccgaagcccacctgctggacagcaaggtg
ccctcagtggagctcaccaacctgtatccctattgcgactacgaaatgaaggtgtgcgcc
tacggggcacacggggaggggccctatagctcactggtgtcctgccgcacccaccaggaa
gtgcccagtgagccaggaaggctggctttcaatgtagtttcttctacggtgacccagctg
agctgggcagaaccagctgaaaccaacggggagatcacagcctatgaggtctgctatgga
ctggtcaacgaggacaaccgacccattggacctatgaagaaggtgcttgtggacaacccc
aagaaccggatgctgctcattgagaatcttcgagagtcccagccataccgatacacggtg
aaggcgcgaaacggggcaggatggggacccgagagagaggctatcatcaacctggccaca
cagcccaagcggcccatgtccattcctatcatcccagacatccccatagtggacgcccag
ggtggagaagactacgaaaacttcctcatgtacagtgacgacgttctgcgctccccagcc
agcagccagaggcccagcgtttcagatgacactgagcacctggtgaatggccggatggac
tttgcctatccaggcagtgccaactccctgcataggatgactgctgccaacgtggcctat
ggcacacatctaagcccacaccagacccaccgaatgctgagcacgtcttctacccttacc
cgggactaccactctctgacgcgcacagaccactctcagtcaggcacacttccccgggac
tactccactctcacttccctttcctcccaaggcctccctcctatctgggaagatgggagg
agcaggcttccgctgtcctggacccttgggtcctggagccgggctcagatgaagggtgtg
cccgcatccaggggctcaccagactctataatcctggccgggcagtcagcagcgccctcc
tggggtacagattcccgtggggctatgggtgtgcccgacacacccactcggctggtgttc
tccgccctggggcccacatctctgaaggtgagctggcaggagccacagtgtgatcgagca
ctgctgggctacagcgtggaataccagctactcaacggcggcgagatgcatcggctcaac
atccctaaccctggccaaacctctgtggtggtagaggatctcctgcctaaccactcctat
gtgttccgggtacgggcacaaagccaggagggctggggccgggagcgagagggtgtcatc
accatcgagtcccaggtgcacccgcagagccctctctgccccctgccaggctccgccttc
accttgagcacccccagcgccccaggccccctggtgttcactgccctaagcccagactct
ctgcagctgagctgggagcgcccaagaaggcccaacggagatatccttggctacctggtg
acctgtgagatggcccaaggaggaggaccagccagaaccttccgggtggatggggacaac
cctgagagccggctgacggttcctggcctcagtgagaacgttccttacaagttcaaggtg
caggcccggacaacagagggctttgggcccgagcgtgagggtatcatcaccatcgagtct
caggatggaggccccttcccacagctgggcagccattctgggcttttccagaacccactg
caaagtgagtacagcactgtcaccagcactcacagcactaccaccaccgagcccttcctt
atagatggactaaccctggggacccagcgcctggaagcagggggctccctcacccggcat
gtgacccaggaatttgtgagccggaccctgaccaccagtggctctctcagcactcatatg
gaccaacagttcttccaaacctga

DBGET integrated database retrieval system