KEGG   Rattus norvegicus (rat): 25729
Entry
25729             CDS       T01003                                 

Gene name
Ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05161  Hepatitis B
rno05162  Measles
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
rno05222  Small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25729 (Ccne1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25729 (Ccne1)
   04114 Oocyte meiosis
    25729 (Ccne1)
   04115 p53 signaling pathway
    25729 (Ccne1)
   04218 Cellular senescence
    25729 (Ccne1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25729 (Ccne1)
   05206 MicroRNAs in cancer
    25729 (Ccne1)
   05203 Viral carcinogenesis
    25729 (Ccne1)
  09162 Cancer: specific types
   05226 Gastric cancer
    25729 (Ccne1)
   05215 Prostate cancer
    25729 (Ccne1)
   05222 Small cell lung cancer
    25729 (Ccne1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25729 (Ccne1)
   05161 Hepatitis B
    25729 (Ccne1)
   05162 Measles
    25729 (Ccne1)
   05169 Epstein-Barr virus infection
    25729 (Ccne1)
   05165 Human papillomavirus infection
    25729 (Ccne1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25729 (Ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    25729 (Ccne1)
   03036 Chromosome and associated proteins [BR:rno03036]
    25729 (Ccne1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    25729 (Ccne1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    25729 (Ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 25729
NCBI-ProteinID: NP_001094291
RGD: 2294
Ensembl: ENSRNOG00000014786
UniProt: B1WC54
Position
1
AA seq 411 aa
MPRERKERDSKDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSQDSSQ
PWDDDSACVDPCSFIPTPNKEEDNELEYPKTAFQPRKIRPPRASPLPVLNWGNREEVWRI
MLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMAS
QQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKW
RLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVL
AASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHN
IQTHTNSLDLLDKAQAKKAILSEQNRISPPPSGVLTPPHSSKKQSSEQETE
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccaagggagaggaaggagagagactcgaaggaccacagcaacatgaaagaagaaggt
ggctccgacctctcagtccgatccagaaaaaggaaggcaaatgtggccgtttttttgcaa
gatccggatgaagaaattgccaagattgacaagactgtgaaaagccaggatagcagtcag
ccttgggatgatgattcagcgtgcgtggacccctgctctttcatccccacccctaacaaa
gaagaggacaatgagcttgagtaccccaagactgcatttcagcctcggaaaatcagaccg
cccagagcctccccacttcccgtcttgaattggggcaatagagaagaggtctggaggatc
atgttaaacaaagagaagacttacctgagagatgagcactttctgcagcgccaccctctc
ctgcaggcgaggatgagagcagttcttctggactggctgatggaggtgtgtgaagtctat
aagctccacagagagacattctacttggcacaggacttctttgatcgttacatggcatca
caacagaatatcataaaaacacttttacagcttattgggatttcagccttatttattgct
tctaaacttgaggaaatctaccctccaaagttgcaccagtttgcttatgttactgatggt
gcttgctccggggatgaaattcttaccatggaactgatgatgatgaaggcccttaagtgg
cgtttaagccccctgaccattgtgtcctggctgaatgtttatgtccaagtggcctacgtc
aacgacacgggagaagtgctgatgcctcagtacccacagcaggtcttcgtgcagatcgca
gagcttttagacctgtgcgtcctggatgttggctgcttagaatttccttatggtgtcctc
gctgcttctgctttgtatcatttttcctcgttggagttgatgcagaaggtctcaggttat
cagtggtgtgatatagagaagtgtgtcaagtggatggttccattcgccatggttatccgg
gagatgggaagttccaagctcaagcacttccggggagttcccatggaagactcccacaac
atccagacccacaccaacagcttggacttgctggacaaagcccaagcaaagaaagccata
ttgtcagaacaaaataggatttctcctcctccgagtggggtcctgacacccccacacagc
agtaagaagcagagcagtgagcaggagacagaatga

KEGG   Rattus norvegicus (rat): 362485
Entry
362485            CDS       T01003                                 

Gene name
Ccne2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05161  Hepatitis B
rno05162  Measles
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
rno05222  Small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    362485 (Ccne2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362485 (Ccne2)
   04114 Oocyte meiosis
    362485 (Ccne2)
   04115 p53 signaling pathway
    362485 (Ccne2)
   04218 Cellular senescence
    362485 (Ccne2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362485 (Ccne2)
   05206 MicroRNAs in cancer
    362485 (Ccne2)
   05203 Viral carcinogenesis
    362485 (Ccne2)
  09162 Cancer: specific types
   05226 Gastric cancer
    362485 (Ccne2)
   05215 Prostate cancer
    362485 (Ccne2)
   05222 Small cell lung cancer
    362485 (Ccne2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    362485 (Ccne2)
   05161 Hepatitis B
    362485 (Ccne2)
   05162 Measles
    362485 (Ccne2)
   05169 Epstein-Barr virus infection
    362485 (Ccne2)
   05165 Human papillomavirus infection
    362485 (Ccne2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    362485 (Ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    362485 (Ccne2)
   03036 Chromosome and associated proteins [BR:rno03036]
    362485 (Ccne2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    362485 (Ccne2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    362485 (Ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 362485
NCBI-ProteinID: NP_001102126
RGD: 1307783
Ensembl: ENSRNOG00000008055
UniProt: D3ZQ41
Position
5
AA seq 405 aa
MSRRSSRLQAKQQHARPNQPDSPQEAQIIQAKKRKTAQDVKKRTEEITKKHQYEIRNCWP
PVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQ
KESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
VNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELC
PVTVISWLNLFLQVDAVKDIPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAA
ALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQT
HTNYLALLNEVNYVNIFRKGGQLSPVCNGGIMTPPKSTEKPPVKF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagcatgcccggcccaaccagcca
gactctccacaagaagcccagataattcaggccaagaagagaaaaacagcacaggatgtc
aaaaaaagaacagaggagatcaccaagaagcatcagtatgagattaggaattgttggcca
cctgtactgtctggaggaatcagtccttgcattatcattgaaacgccccataaagaaata
ggaacaagtgacttctctaggtttacaaactacagatttaaaaatctttttattaatccc
tcacctctgccagacttaagctgggcatgttcacaggaggtttggcaaaacatgctacaa
aaggaaagcagatacgtgcatgacaaacattttgaagttctgcattctgacctggaacca
caaatgaggtcaatacttttagactggcttttagaggtctgtgaagtatatactcttcat
agggaaacattttaccttgcccaagacttttttgacagatttatgttgacacaaaaggat
gtaaataaaaatatgcttcaactcattgggattacctcattgttcattgcttccaaactt
gaggaaatctacgctcccaagctccaagagtttgcttatgtcactgatggtgcttgcagt
gaagtagatatcttaaagatggaactcaatatattaaaggctttaaaatgggaactttgt
ccagtaacagtcatttcctggttgaatctttttctccaagttgatgctgttaaagacatt
cctaaggttcttctacctcagtattctcaggagacgttcatccaaatagctcagctttta
gatctgtgcattctagccattgactctttagaatttcaatacagaattctggccgccgct
gccttatgccattttacttccatcgaagtggttaagaaagcttcaggtttggaatgggat
gacatctcagaatgtgtagactggatggtgccttttgtcagtgttgtaaaaagtgtaagt
ccagtgaagctgaagacttttaagaagatacccatggaggacagacacaatatccagaca
cacacaaattacttggctttgctgaatgaagtaaactatgtgaacatcttcagaaaagga
gggcagttgtcaccagtgtgtaatggaggcattatgacaccaccgaagagcactgagaaa
ccaccagtaaagttctga

DBGET integrated database retrieval system