KEGG   Rattus norvegicus (rat): 25732
Entry
25732             CDS       T01003                                 

Gene name
Acp5, TTRRAP, Trap
Definition
(RefSeq) acid phosphatase 5, tartrate resistant
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00740  Riboflavin metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
rno04380  Osteoclast differentiation
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    25732 (Acp5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25732 (Acp5)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25732 (Acp5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    25732 (Acp5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     25732 (Acp5)
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 25732
NCBI-ProteinID: NP_001257818
RGD: 2022
Ensembl: ENSRNOG00000046261
UniProt: P29288
Structure
PDB: 
1QHW 1QFC

Position
8q13
AA seq 327 aa
MDTWMVLLGLQILLLPLLAHCTAPASTLRFVAVGDWGGVPNAPFHTAREMANAKEIARTV
QIMGADFIMSLGDNFYFTGVHDANDKRFQETFEDVFSDRALRNIPWYVLAGNHDHLGNVS
AQIAYSKISKRWNFPSPYYRLRFKVPRSNITVAIFMLDTVMLCGNSDDFVSQQPEMPRDL
GVARTQLSWLKKQLAAAKEDYVLVAGHYPIWSIAEHGPTRCLVKNLRPLLAAYGVTAYLC
GHDHNLQYLQDENGVGYVLSGAGNFMDPSVRHQRKVPNGYLRFHYGSEDSLGGFTYVEIG
SKEMSITYVEASGKSLFKTSLPRRPRP
NT seq 984 nt   +upstreamnt  +downstreamnt
atggatacgtggatggtgctgctgggcctgcaaatcctgctgctcccactcctggctcac
tgtacagccccagcttccaccctgagattcgtggctgtgggtgactggggaggggtcccc
aatgccccattccacacagcccgggaaatggccaatgctaaagaaatcgccagaaccgtg
cagattatgggcgctgacttcatcatgtccctgggggacaacttctacttcactggagtg
catgacgccaatgacaagaggttccaggagacctttgaggatgtgttctctgaccgtgcc
ctccgcaacatcccctggtacgtgctggctggaaaccatgatcaccttggcaatgtctcg
gcacaaattgcctactccaagatctccaagcgctggaacttccccagcccttattaccgt
ttgcgtttcaaagttccgcggtcgaacatcaccgtggccatctttatgctggacaccgtg
atgctgtgtggcaattccgacgactttgtcagccagcagcctgaaatgccccgagacctg
ggagtggcccgcactcagctgtcctggctcaaaaaacagttggcagcagccaaggaggac
tatgttttggtggccggtcactaccccatctggtccatcgccgagcacggacccacccgc
tgcctggtcaagaacttgaggccattgttggctgcatacggggtcaccgcctacctgtgt
gggcatgaccacaacctgcagtatcttcaggatgagaacggtgtgggctatgtgctgagt
ggggccggcaacttcatggacccttccgtgcggcatcaacgaaaggtccccaacggctac
ctacgctttcactatggatctgaggactctctgggtggcttcacatacgtggagataggc
tccaaagaaatgagcatcacgtatgtggaagcctctggaaaatcactcttcaagaccagc
ctccccaggcgacccagaccctga

DBGET integrated database retrieval system