KEGG   Rattus norvegicus (rat): 25734
Entry
25734             CDS       T01003                                 

Gene name
Hck
Definition
(RefSeq) tyrosine-protein kinase HCK
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    25734 (Hck)
   04062 Chemokine signaling pathway
    25734 (Hck)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    25734 (Hck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25734 (Hck)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25734 (Hck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25734 (Hck)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   25734 (Hck)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    25734 (Hck)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 25734
NCBI-ProteinID: NP_037317
RGD: 2785
Ensembl: ENSRNOG00000009331
UniProt: P50545
Position
3
AA seq 524 aa
MGGRSSCEDPGCPRGEGRVPRMGCVKSRFLREGSKASKIEPNANQKGPVYVPDPTSPKKL
GPNSINSLPPGVVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEESGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVVHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYSIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt   +upstreamnt  +downstreamnt
ctggggggtcgttcgagctgcgaggatccgggctgcccgcgaggcgaagggcgggtgccc
aggatgggatgtgtgaagtccaggttcctccgagaaggaagcaaggcctcaaaaatagag
ccaaatgccaaccagaaaggccctgtgtatgtgccggatcccacgtcccctaagaagctg
ggaccgaacagcatcaacagcctgcccccgggggtcgtggagggctctgaggacaccatt
gtggtcgcactgtacgactatgaggccattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggagtctggggagtggtggaaggcccgttccctggctacc
aagaaagaaggctatatcccaagcaattatgtagctcgagttaactctttggagactgag
gagtggttcttcaagggtatcagccggaaggatgcagagcgccacctgctggctcccggg
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcactt
tctgttcgagactttgacccccagcacggagacacggtgaagcattataaaatccggaca
ctggacagtggaggcttctacatctctccgaggagcaccttcagcagcctgcaggaactt
gtcgtccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcctgggagattcctcgagaatccctc
cagatggagaagaaactgggagccgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtctgtggaggccttc
ctggcagaggccaacctgatgaagacgttacagcatgataaactggtgaagctgcacgcc
gtggtctctcaggagcccatctttattgtcaccgagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatttcagagggcatggctttcattgagcagaggaactacatccaccgagacctc
cgggctgccaacatcttggtttctgcatcactggtgtgtaagatcgctgactttggactg
gcacggatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggctccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaatcgtcacctacggccggatcccttacccaggtatgtca
aacccagaggtgattcgagcactagagcatgggtaccgtatgcctcgaccagataactgc
ccagaggagctctacagtatcatgatccgctgctggaagaaccgtccagaggaacggccc
actttcgaatacatccagagcgtgctggatgacttctacacggccactgagagccagtat
cagcagcaaccttga

KEGG   Rattus norvegicus (rat): 79113
Entry
79113             CDS       T01003                                 

Gene name
Fgr
Definition
(RefSeq) tyrosine-protein kinase Fgr
  KO
K08891  tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    79113 (Fgr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79113 (Fgr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79113 (Fgr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     79113 (Fgr)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   79113 (Fgr)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    79113 (Fgr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 zf-RING_14 Haspin_kinase ABC1 SH3_3
Other DBs
NCBI-GeneID: 79113
NCBI-ProteinID: NP_077059
RGD: 621319
Ensembl: ENSRNOG00000009912
UniProt: Q6P6U0
Position
5
AA seq 517 aa
MGCVFCKKLEPAPKEDVGLEGDFRSQGAEERYYPDPTQGRSSSISPQPISPAFLNVGNIR
SVSGTGVTIFVALYDYEARTGDDLTFTKGEKFHILNNTEYDWWEARSLSSGRTGYVPSNY
VAPVDSIQAEEWYFGKISRKDAERQLLSDGNPQGAFLIRESETTKGAYSLSIRDWDQNRG
DHIKHYKIRKLDMGGYYITTRAQFESVQDLVRHYMEVNDGLCYLLTAPCMVMKPQTLGLA
KDAWEIDRNSIALDRRLGTGCFGDVWLGTWNCSTKVAVKTLKPGTMSPKAFLEEAQIMKL
LRHDKLVQLYAVVSEEPIYIVTEFMCYGSLLDFLKDRKGHNLMLPNLVDMAAQVAEGMAY
MERMNYIHRDLRAANILVGEHLICKIADFGLARLIVDDEYNPQQGTKFPIKWTAPEAALF
GRFTVKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVEHGYHMPCPPGCPVSLYEVME
QTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaagttagagcctgcacccaaggaggatgttggcctggaa
ggggacttccggagccaaggcgctgaagaacgctattaccctgaccctactcaaggccgg
tcttcgtccatctcgcctcagcccatcagccctgctttccttaatgttggcaacataaga
agcgtctctgggacgggagtgaccatattcgtcgccctgtatgactatgaggccaggaca
ggggatgacctcaccttcaccaaaggcgagaagttccacatcctgaacaatacggagtat
gactggtgggaggctaggtccctgagctccggacgcacgggctatgttcccagcaactat
gtggctcccgtggattccatccaggctgaagagtggtacttcggaaagatcagcagaaag
gatgcagagaggcagcttctctccgatggcaaccctcaaggggcctttctcattcgggaa
agcgagaccaccaaaggtgcctactccctgtccatccgtgactgggaccagaacagaggc
gaccacataaagcattacaagatccgaaagctggacatgggtggctactacatcaccacg
cgggcccagttcgaatccgtgcaggacctggtgcggcactacatggaagtgaatgacggt
ctatgctacttgctcacggcaccctgtatggtcatgaagccccagactctaggcctggct
aaggatgcctgggagatcgaccgtaactccatagcacttgaccgcaggctgggcaccggc
tgctttggagacgtgtggctgggcacgtggaactgtagcacaaaggtggcagtgaaaacg
ctgaagccaggcaccatgtcgccgaaggccttcctggaggaggcacagatcatgaaactg
ctgaggcacgacaagctggtgcagctgtacgcggtggtgtcagaggaacccatttatatt
gtgacagagttcatgtgctatggtagcttgctggatttcctaaaggatcgaaagggtcac
aacttgatgctgcccaatctagtggacatggctgcccaggtagcagagggcatggcctac
atggagcgcatgaactatatccaccgagacctgagagcagccaacatcctggtgggggaa
catctaatatgcaagatcgctgactttgggttggcacgcctcatagtggatgatgagtac
aacccccaacaaggaaccaagtttcccatcaagtggacagccccagaggctgctctcttt
ggcagattcactgtcaaatcagacgtgtggtcctttgggattctgctcactgaactgatc
accaagggcagagttccatacccaggtatgaacaaccgggaagtgttggaacaggtagag
cacggctaccacatgccatgccctccgggatgcccagtatccctgtatgaggtcatggag
cagacctggcgtctggatccagaggagaggcccacctttgagtacctgcagtctttcctg
gaagactatttcacctccacagaaccacagtatcagcccggagaccagacatag

KEGG   Rattus norvegicus (rat): 81515
Entry
81515             CDS       T01003                                 

Gene name
Lyn
Definition
(RefSeq) tyrosine-protein kinase Lyn isoform A
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04611  Platelet activation
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04730  Long-term depression
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    81515 (Lyn)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81515 (Lyn)
   04662 B cell receptor signaling pathway
    81515 (Lyn)
   04664 Fc epsilon RI signaling pathway
    81515 (Lyn)
   04666 Fc gamma R-mediated phagocytosis
    81515 (Lyn)
   04062 Chemokine signaling pathway
    81515 (Lyn)
  09156 Nervous system
   04730 Long-term depression
    81515 (Lyn)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81515 (Lyn)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    81515 (Lyn)
   05169 Epstein-Barr virus infection
    81515 (Lyn)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81515 (Lyn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81515 (Lyn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81515 (Lyn)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     81515 (Lyn)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   81515 (Lyn)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    81515 (Lyn)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1 SH3_3 Haspin_kinase
Other DBs
NCBI-GeneID: 81515
NCBI-ProteinID: NP_110484
RGD: 621017
Ensembl: ENSRNOG00000008180
UniProt: Q07014
Position
5
AA seq 512 aa
MGCIKSKRKDNLNDDGVDMKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQAKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSAQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGSKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KESAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggatgtattaaatcaaaaaggaaagacaatctgaatgacgatggagtagatatgaag
actcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttcctgaatctcaacttttaccaggacagagatttcaagcaaaagat
ccagaggagcaaggggacattgtggtggccttgtatccctatgatggcatccacccagac
gacttgtctttcaagaaaggagaaaagatgaaagttctggaagagcacggggagtggtgg
aaagctaagtccctttcatcaaagagagaaggcttcatccccagcaactacgtggccaag
gtcaacaccttagaaaccgaagagtggttcttcaaggacataacaaggaaagatgcagaa
cgacagcttctggcaccagggaacagtgccggggctttcctgatcagagaaagtgaaact
ttaaagggaagcttctctctttccgtcagagattacgaccctatgcatggcgacgtcatt
aagcactacaaaatcagaagcctggacaatggtggttattacatctctccgaggatcact
tttccctgtatcagtgacatgattaagcattaccaaaagcagtctgatggtctatgcaga
agactggagaaggcatgcatcagtcccaaaccacagaagccatgggataaagatgcttgg
gagatcccccgggagtccattaagctggtgaaaaaactcggcgcagggcagttcggggaa
gtctggatgggttactataacaacagcacaaaagtggctgtaaagaccctcaagcctggc
accatgtctgctcaagcattcctggaagaggccaacctcatgaagaccttgcagcatgac
aagctagtgcggctgtatgccgtggtcaccaaggaggagcccatctacatcattaccgag
ttcatggccaagggtagcttgctggatttcctcaagagtgacgaaggcagcaaggttctg
ctcccgaaactcattgacttttcagctcagattgcagaaggcatggcgtacatcgagcgg
aagaactacatccaccgcgatctgcgagctgccaacgtgctggtctctgagtctctcatg
tgcaagattgcagactttggcctcgcgagagtaatcgaagataatgaatacacagcgagg
gaaggtgccaagttccctatcaagtggacggctccagaggccatcaacttcggctgcttc
actatcaagtctgacgtgtggtccttcggaattctcctgtacgagatcgtcacctatggg
aagattccctacccagggagaactaacgcagatgtgatgaccgcactgtcacaggggtac
cgaatgccacgaatggagaactgtccagatgagctctatgacatcatgaaaatgtgctgg
aaggaatcagcagaggagaggccaacctttgactacttacagagtgtactggatgacttc
tacactgccacggaagggcagtatcagcagcagccatag

KEGG   Rattus norvegicus (rat): 83805
Entry
83805             CDS       T01003                                 

Gene name
Src
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04137  Mitophagy - animal
rno04144  Endocytosis
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04625  C-type lectin receptor signaling pathway
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05219  Bladder cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    83805 (Src)
   04015 Rap1 signaling pathway
    83805 (Src)
   04370 VEGF signaling pathway
    83805 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83805 (Src)
   04137 Mitophagy - animal
    83805 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    83805 (Src)
   04520 Adherens junction
    83805 (Src)
   04530 Tight junction
    83805 (Src)
   04540 Gap junction
    83805 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    83805 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    83805 (Src)
   04613 Neutrophil extracellular trap formation
    83805 (Src)
   04625 C-type lectin receptor signaling pathway
    83805 (Src)
   04062 Chemokine signaling pathway
    83805 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    83805 (Src)
   04915 Estrogen signaling pathway
    83805 (Src)
   04917 Prolactin signaling pathway
    83805 (Src)
   04921 Oxytocin signaling pathway
    83805 (Src)
   04926 Relaxin signaling pathway
    83805 (Src)
   04919 Thyroid hormone signaling pathway
    83805 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    83805 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    83805 (Src)
  09158 Development and regeneration
   04360 Axon guidance
    83805 (Src)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    83805 (Src)
   05203 Viral carcinogenesis
    83805 (Src)
  09162 Cancer: specific types
   05219 Bladder cancer
    83805 (Src)
  09172 Infectious disease: viral
   05161 Hepatitis B
    83805 (Src)
   05168 Herpes simplex virus 1 infection
    83805 (Src)
   05163 Human cytomegalovirus infection
    83805 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    83805 (Src)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    83805 (Src)
   05152 Tuberculosis
    83805 (Src)
   05100 Bacterial invasion of epithelial cells
    83805 (Src)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    83805 (Src)
   05418 Fluid shear stress and atherosclerosis
    83805 (Src)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    83805 (Src)
   01522 Endocrine resistance
    83805 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83805 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83805 (Src)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     83805 (Src)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   83805 (Src)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    83805 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    83805 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    83805 (Src)
  Macropinocytosis
   Kinases
    83805 (Src)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 83805
NCBI-ProteinID: NP_114183
RGD: 620795
Ensembl: ENSRNOG00000009495
UniProt: Q9WUD9
Position
3
AA seq 542 aa
MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLK
GETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagaggcgccgcagcctggagccc
gcggagaacgtgcatggggcaggtggcgccttccctgcctcacagacaccaagcaagcct
gcctccgccgatggccaccgcgggcccaatgccgcctttgtgccccccgcggccgccgag
cccaagctcttcggaggcttcaactcctcggacactgtcacctccccacaaagggcgggg
cctctggcaggtggggtgactacctttgtggccctctatgactatgagtcacggacagag
actgacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtg
gatgtcagagagggagactggtggctggcacactcgctgagcaccggacagaccggttac
atccccagtaactatgtggcgccctccgactccatccaggctgaggagtggtactttggc
aagatcactagacgggaatcagagcggctacttctcaacgccgagaaccccagagggacc
ttcctcgtgagggagagtgagaccacaaaaggtgcctactgcctctctgtatccgacttt
gacaatgccaagggcctaaatgtgaaacactacaagatccggaaactggacagtggcgga
ttctacatcacctcccgcacgcaattcaacagcctgcagcagcttgtggcttactactcc
aaacatgctgatggcctgtgtcaccgtctcactaccgtgtgtcccacatccaagcctcag
acccagggcctggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtc
aagctgggccagggttgcttcggagaggtgtggatggggacctggaacggcaccacgagg
gttgccatcaaaaccctgaagccaggcaccatgtctccagaggccttcctgcaggaggcc
caagtcatgaagaaactgaggcatgagaagctggtgcagctgtatgccgtggtgtcagaa
gaacccatttacattgtgacagagtacatgaacaaggggagtctgctggactttctcaag
ggggaaacgggcaaatacttgcggctaccccagctggtggacatgtctgctcagattgct
tcaggcatggcctatgtggagcggatgaactatgtgcaccgggacctccgagccgccaat
atcctggttggcgagaacctggtgtgcaaagtggccgactttgggctggcccggctcata
gaggacaacgaatacacagctcggcaaggtgccaaattccccatcaagtggaccgcccct
gaagcggctctgtatggcaggttcaccatcaagtcggacgtgtggtcctttggaatcctg
ctgactgagctcaccactaagggcagagtgccctatcctgggatggtgaaccgagaggtg
ctggaccaggtagagcggggctaccggatgccttgtccccccgagtgccctgagtccctg
catgacctcatgtgccagtgctggcggaaggagcctgaggagcggcccaccttcgagtac
ctgcaggccttcctggaggactactttacgtccacggagccgcagtaccagcccggggag
aacctatag

DBGET integrated database retrieval system