KEGG   Rattus norvegicus (rat): 25736Help
Entry
25736             CDS       T01003                                 

Gene name
Kcnb1, DRK1PC, Kcr1-1, Kv2.1, Shab
Definition
(RefSeq) potassium voltage-gated channel subfamily B member 1
  KO
K04885  potassium voltage-gated channel Shab-related subfamily B member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25736 (Kcnb1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   25736 (Kcnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kv2channel Ion_trans BTB_2 Ion_trans_2 DUF4790
Motif
Other DBs
NCBI-GeneID: 25736
NCBI-ProteinID: NP_037318
RGD: 2954
Ensembl: ENSRNOG00000046949
UniProt: P15387 A0A0H2UI34
Position
3q42
AA seq 853 aa AA seqDB search
MTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCN
THDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGI
DEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNS
SVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQSTDNPQLAHVEAVCIAWFTMEY
LLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRI
LRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSI
PASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK
RQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGESIAKKDKVQDNHLS
PNKWKWTKRALSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYSKMAKTQSQPI
LNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVIDMRSMSSIDSFISCATDFPEATRF
SHSPLASLSSKAGSSTAPEVGWRGALGASGGRLTETNPIPETSRSGFFVESPRSSMKTNN
PLKLRALKVNFVEGDPTPLLPSLGLYHDPLRNRGGAAAAVAGLECASLLDKPVLSPESSI
YTTASARTPPRSPEKHTAIAFNFEAGVHHYIDTDTDDEGQLLYSVDSSPPKSLHGSTSPK
FSTGARTEKNHFESSPLPTSPKFLRPNCVYSSEGLTGKGPGAQEKCKLENHTPPDVHMLP
GGGAHGSTRDQSI
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcatggctcgcgctccaccagctcgctgccgcccgagcccatggagatcgtg
cgcagcaaggcgtgctcgcgccgggtgcgcctcaacgtcgggggcctggcgcacgaggtg
ctgtggcgcactctggaccgcctgccccgcacgcggctgggcaagcttcgggactgcaac
acgcacgactccctgctccaggtgtgcgacgactacagccttgaggacaacgagtacttc
ttcgaccgccaccctggcgcctttacctccattctcaatttctaccgcaccggccggctg
cacatgatggaggagatgtgcgcgctgagcttcagccaggagctggactactggggcatc
gatgagatctacctggagtcctgctgccaggcccgctatcaccaaaagaaggagcagatg
aacgaggagctgaagcgcgaggccgagacgctgcgggagcgggagggcgaggagtttgac
aacacgtgctgtgcagagaagaggaagaaactctgggatctgctggagaagcccaactcg
tcggtggccgccaagatcctggccatcatctcgatcatgttcatcgtcctgtccaccatc
gctctgtcactcaacacgctgcctgagctgcagagcctagacgagttcggccagagcacg
gataacccgcagctggcgcacgtggaggcggtgtgcatcgcatggttcaccatggagtac
ttgctgaggttcctgtcctcccccaagaaatggaagttcttcaagggccccctcaacgcc
attgacctactggccatcctgccctactacgtcaccatcttcctcacagaatccaacaag
agcgtgctgcagttccagaacgtgcgccgcgtggtccagatctttcgcatcatgcgcatc
cttcggatcctgaagctggcccgtcactccactggcctgcagtccttgggcttcaccctg
cgcagaagctacaacgaactgggcctgctcatcctcttcctcgcgatgggcatcatgatc
ttctccagcctggtcttcttcgcggagaaggatgaggacgacaccaagttcaaaagcatc
cccgcctctttctggtgggctaccatcaccatgacaactgttggctatggagacatctac
ccgaagactctcctggggaaaatcgtgggggggctctgttgcattgccggggtcctggtg
attgctctccccatccccatcatcgtcaataacttctccgagttctacaaggagcagaag
cgccaggagaaagccatcaagcggagggaggctctggagagagccaagaggaatggcagc
atcgtgtccatgaacatgaaggacgccttcgcccggagcatcgagatgatggacatcgtg
gtggagaaaaatggcgagagcatagctaagaaggataaagtgcaagataaccacctgtcc
cccaacaagtggaaatggaccaagagggcactctccgagaccagctccagtaagtccttt
gaaaccaaggagcagggatcccccgaaaaggccaggtcctcgtctagtccacagcacttg
aacgtccagcagctggaagacatgtacagtaagatggccaagacacagtcccagcccatc
ctcaacaccaaggagatggccccgcagagcaagcctccagaggagctggagatgagcagc
atgcccagccccgtggcccctctgcccgcacgcacggagggcgtcatcgacatgcggagc
atgtccagcattgacagcttcatcagctgtgccacggacttccctgaagccaccagattc
tcccacagtcctctggcatccctctccagcaaggctgggagcagcacagccccggaggtg
ggctggcggggggctctgggtgccagcggcgggaggctcacggagaccaaccccattcct
gagaccagccgctctggtttcttcgtggagagtcccaggagttccatgaagaccaacaac
cccttgaagctgcgagcgctcaaggtcaacttcgtggagggcgaccccaccccgctgctg
ccctccctgggcttgtatcacgatcctcttaggaacagaggaggggcagcggctgcagtt
gcgggactggagtgtgcctccctcttagacaagcccgtgctgagcccagagtcctccatc
tacaccacagcaagtgccaggacgccccctcgctcccctgagaaacacacagcaatagca
ttcaacttcgaggcgggagtccaccattacatagacaccgacacagatgacgagggtcag
ctgctctacagcgtggactccagccctcccaaaagtctccacgggagtaccagtcccaag
ttcagcactggagctagaacggagaagaaccacttcgagagctcccccttgcccacctcc
cctaagttcttaaggccgaactgtgtctactcctcagaagggttgactggaaaaggccct
ggggctcaagagaaatgcaagctggagaaccatacccccccggatgtgcacatgctgcct
gggggaggagcacacgggagcactagggatcagagtatctga

DBGET integrated database retrieval system