KEGG   Rattus norvegicus (rat): 25739
Entry
25739             CDS       T01003                                 
Symbol
Pygb
Name
(RefSeq) glycogen phosphorylase, brain form
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04217  Necroptosis
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Module
rno_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    25739 (Pygb)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25739 (Pygb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25739 (Pygb)
   04922 Glucagon signaling pathway
    25739 (Pygb)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25739 (Pygb)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     25739 (Pygb)
SSDB
Motif
Pfam: Phosphorylase TPR_22
Other DBs
NCBI-GeneID: 25739
NCBI-ProteinID: NP_037320
RGD: 3460
Ensembl: ENSRNOG00000007583
UniProt: P53534
Position
3:139611724..139658521
AA seq 843 aa
MAKPLTDSERQKQISVRGIAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQTACDEATYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPNGVLWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLKDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDLSQLKKLLSLVDDEAFIRDVAKVKQ
ENKLKFSAQLEKEYKVKINPASMFDVHVKRIHEYKRQLLNCLHIITLYNRIKKDPTKTFV
PRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVE
ALDQKGYNAREFYERLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMYHDRFKVFADYEA
YIQCQAQVDHLYRNPKDWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNL
PKD
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcgaagccattgacggacagtgagaggcagaagcagatcagtgtgcgtggcatcgcc
gggctaggcgacgtggccgaggtgcggaagagcttcaacaggcacctgcacttcacgctg
gtcaaggaccgcaatgtggccactccccgcgactacttcttcgctctggcacacacggtt
cgcgaccacctagtgggccgctggatccgcacgcaacagcattactacgaacgggacccc
aagcgtatctactacctttccctggaattctacatgggccgcacactgcagaacaccatg
gtgaacctgggccttcagactgcatgtgatgaagccacttatcagttggggttggacttg
gaagaactagaggaaatagaggaggatgctggccttgggaatggtggcctggggcggctg
gcagcttgcttccttgattcgatggccacgctgggtctagctgcatatggctatggaatc
cgctatgaatttgggattttcaaccaaaagattgtcaatggctggcaggttgaagaagct
gacgactggctgcgctacggaaacccatgggagaaggcgcggccggagtacatgctgcct
gtgcacttctacgggagggtggagcacacccctaacggtgtcctctggctggacacacag
gtggtactcgccatgccctatgacaccccagtgcctgggtataagaacaacaccgtcaac
accatgaggctctggtctgccaaggcacccaatgacttcaagctgaaggacttcaacgtt
ggggactacatcgaagctgtcctggacaggaacttggccgagaacatctccagggtcctg
tatcccaatgacaatttcttcgagggaaaggagctgcggctgaagcaggagtactttgtg
gtggccgccaccctccaggacatcattagaaggttcaagtcgtccaagtttggctgccgg
gatccagtgagaacctgtttcgagacattcccagacaaggtagccatccagctgaatgac
acccatcccgcgctgtccatccccgagctcatgcggatcctggtggacgtggagaaggta
gactgggataaggcctgggagatcaccaagaagacctgtgcctacaccaaccacactgtg
ctgcccgaggccttggagcgctggcccgtgtctatgtttgagaagctgctgccgcgacac
ctggaaatcatctatgccatcaaccagaggcacctggatcacgtggctgccctgtttccc
ggggatgtggaccgcttgaggaggatgtctgtgattgaggaaggggactgcaagagaatc
aacatggcacacctgtgtgtgattgggtcccacgccgtgaacggggtggcaaggattcac
tccgagatcgtgaagcagtctgtcttcaaggacttttatgagctggagccagagaagttc
cagaacaagaccaatggtatcacgccccgacggtggctgctcttgtgcaatccggggctg
gcagaaatcattgtggagagaatcggggaaggtttcctgactgatctgagccaactgaag
aagctgctgtcactggttgatgatgaggccttcatcagggatgtagccaaggtcaagcag
gaaaacaagctgaagttctctgcccagctagagaaggaatacaaggtgaagatcaaccct
gcgtccatgtttgatgtgcacgtcaagaggatccacgagtacaagcggcagctgctcaac
tgcttacacatcatcaccctgtacaaccgaataaagaaggatccaaccaagacctttgtg
cccaggactgttatgatcggaggcaaggcagctcctggttaccacatggctaagatgatc
atcaagctggtcacatccattggagatgttgtcaatcatgatccagttgtgggcgacagg
ctcagagtgatcttcctggagaactaccgtgtgtctttagctgagaaagtgatcccagcc
gccgacctgtcacagcagatctccactgcgggcaccgaggcctcgggcaccggcaacatg
aagttcatgctcaacggagctctcaccatcggcaccatggatggtgccaacgtggagatg
gccgaggaggccggggaggagaacctcttcatctttggtatgcgggtggaagatgttgag
gccttggaccagaaagggtacaatgccagagaattctacgagcgcctgcctgagctgagg
caggctgtggatcagatcagcagtggcttcttttctcccaaagatccagactgcttcaag
gatgtggttaacatgctgatgtaccatgacagattcaaggtatttgcagactatgaagcc
tacatccaatgccaggcccaggtggaccatctataccggaatcccaaggattggactaaa
aaggtgatcagaaatatagcctgctctggcaaattctccagtgaccggaccatcactgag
tatgcccgggagatctggggtgtagagccctctgacctgcagatcccaccccctaatctc
cccaaggactaa

DBGET integrated database retrieval system