KEGG   Rattus norvegicus (rat): 25745
Entry
25745             CDS       T01003                                 

Gene name
Myh9
Definition
(RefSeq) myosin-9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25745 (Myh9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25745 (Myh9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25745 (Myh9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25745 (Myh9)
   04147 Exosome [BR:rno04147]
    25745 (Myh9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25745 (Myh9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   25745 (Myh9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin IQ CC2-LZ ADIP AAA_22
Other DBs
NCBI-GeneID: 25745
NCBI-ProteinID: NP_037326
RGD: 3140
Ensembl: ENSRNOG00000004860
UniProt: G3V6P7
Position
7
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSTKNGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNS
IRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERACRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FSEGERVRTELADKVSKLQVELDSVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCL
ETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESA
VKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRAEKKLKDVLLQVEDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDMPFVVTRRIVRKGTGDCSDEEVDGKADGADAKAAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggcccagcaggctgcagacaagtacctctatgtggataaaaacttcatcaataacccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccaccaagaatggc
tttgaaccagccagccttaaggaggaggtgggagaagaggccattgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgatatccagaagatgaacccacccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgatactactcagggctcatctatacctattcaggcctgttctgtgtggtc
attaatccttataagaacctgcctatctactcagaggagatcgtggacatgtacaagggc
aagaagaggcacgagatgccgccccacatctatgccatcacagacactgcctacaggagc
atgatgcaggaccgagaagatcagtccatcctttgcacgggtgagtctggagcaggcaag
acagagaacaccaagaaagtcatccagtacctggcacatgtggcctcctcacacaagagc
aagaaggaccagggggagctggagcgccaactgctgcaggccaaccctatcctagaggcc
tttggaaacgccaagacggtgaagaatgacaactcttcacgatttggtaaattcattcgt
atcaactttgatgtcaacggctacatcgttggggccaacattgagacttatcttctggag
aaatctcgtgctatccgccaagccaaggaggaaagaaccttccacattttctattacctg
ctgtctggggccggagagcacctgaagactgatctcctgttggagccatacaataaatac
cgcttcctgtccaatgggcatgtcaccatcccagggcagcaggacaaggacatgttccag
gagacaatggaggccatgaggattatgggtatcccagaggatgagcagatgggcttgctg
cgggtcatctctggcgtccttcagcttggcaacattgtcttcaagaaggaacggaacact
gaccaggcgtccatgccagataacacagctgctcaaaaggtgtcccacctcctggggatc
aatgtgaccgacttcaccagaggcatccttaccccgcgcatcaaggtgggcagagactat
gtgcagaaggcacagactaaagagcaggctgactttgccatcgaggctttggccaaggct
acctacgagcggatgttccgctggctggtgcttcgcattaacaaagctctggacaagacc
aagaggcagggcgcctcatttatcgggatcctggacatcgctggcttcgagatctttgat
ctgaactccttcgagcaactttgcatcaactataccaacgagaagctgcagcagctgttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgagagggcatcgagtggaac
ttcatcgactttggccttgacctgcagccttgcatcgacctcattgagaagccggcgggt
cccccaggcatcctggccctgttagatgaggaatgttggttccctaaagccactgacaag
agcttcgtggagaaggtggtgcaggagcagggcacccaccccaagttccagaagcccaag
caactgaaggacaaggctgatttctgcatcatccactatgcaggcaaggtggactataag
gccgatgagtggctgatgaagaacatggaccctctgaacgacaacattgccaccctgctt
caccagtcctcagacaagtttgtctctgagctgtggaaggatgtggatcgaatcattggc
ttggaccaggtggctggaatgtctgagacagcgctacccggtgccttcaagactcggaag
ggcatgttccgtactgtggggcagctgtacaaggagcagctggccaagctcatggccaca
ctgaggaataccaatcccaactttgtccgctgcatcattcccaaccacgagaagaaggcc
ggcaaactggacccacacctggtgctggaccagttacgctgcaatggcgtccttgaaggc
atccgaatctgccgccagggctttcccaacagagtggtcttccaggagttccggcagagg
tatgagatcctcacacctaactccattccgaagggcttcatggatgggaagcaggcgtgt
gtgctcatgatcaaagccttggagcttgacagcaacctgtaccgcatcggccagagcaaa
gtgttcttccgggccggagtcctagctcacctggaggaagagcgggacctgaagatcact
gatgtcatcattggcttccaggcctgctgcagaggctacctggccaggaaggcctttgcc
aagaggcagcagcagctgactgccatgaaggtcctacagaggaactgtgctgcatacctc
agactccgcaactggcagtggtggaggctcttcaccaaggtcaagcccctgctgaactca
ataaggcatgaggatgagcttttagccaaggaggcggaactgacaaaagttcgagagaag
catctggctgcagagaacaggctgacagagatggagactatgcagtctcagctcatggca
gagaagttgcagcttcaggagcagctgcaggcggaaacagagttgtgtgccgaggctgag
gagctccgggcccgcctgacagcgaagaagcaggagttggaggagatctgccatgacctg
gaggccagggtagaggaggaggaggagcgctgccagtatctgcaggcagagaagaagaag
atgcagcagaacatccaggaactcgaggagcagctggaggaggaggagagtgcccggcag
aagctgcagcttgagaaggtgaccactgaggccaagctgaagaaactggaggaggaccag
atcatcatggaggatcaaaactgcaaactggccaaggagaagaagctgctggaagacaga
gtagctgaatttactacaaacctcatggaagaggaggagaagtccaagagcctggccaaa
ctcaagaacaagcacgaggcgatgatcaccgacctggaagagcgccttcgtagggaggag
aagcaaaggcaggagttggagaagacccgccgcaagctagagggagactccacagacctc
agcgaccagattgctgagctccaggcgcagatcgcagagctcaagatgcagctggccaag
aaggaggaggaattgcaggctgccttggccagagtggaagaagaagctgctcagaagaac
atggccctgaagaagattcgagaactggaaactcagatctctgagctgcaggaagacctg
gagtcggagcgagcctgcaggaacaaagctgagaagcagaaacgggatcttggagaagag
ctagaggctctgaagacagagctggaggacactctggactccaccgctgcccagcaggaa
ctgaggtcaaagcgtgagcaggaagtgagcatcctgaagaagactcttgaggatgaggcc
aagacccatgaggcccagatccaggagatgaggcagaagcactcgcaggccgtggaggag
ctggccgagcaattggagcagactaagcgggtaaaagctacccttgagaaggcgaagcag
accctggagaatgagcggggagagctggccaatgaggtgaaggccttgctgcagggcaag
ggcgactcggagcacaagcgcaagaaggtggaggcgcagctgcaagaactgcaggtcaag
ttcagcgagggagagcgtgtacggaccgagctggctgacaaggtctccaagctgcaggtt
gaactggacagcgtgactggtctccttaaccagtcggacagcaagtccagcaagcttaca
aaggacttctctgcgctggagtcccagctccaggacacacaggagctgctccaggaggag
aaccggcagaagctgagcctcagcaccaagctcaagcagatggaggatgagaaaaactcc
ttcagagagcagctggaggaggaagaggaggccaagcgcaacctggagaagcagatcgcc
accctccatgcccaggtgactgatatgaagaagaagatggaggacggtgtagggtgcctg
gagacagcagaggaggcaaagcggaggcttcagaaggacctggaaggcctgagccagcgg
cttgaggagaaggtggctgcctatgataagctggagaagaccaagacccggcttcagcag
gagctggatgacctgctggtggacctggaccaccagcggcagagcgtctccaacctggaa
aagaagcagaagaagtttgaccagctcctagctgaggagaagaccatctcagccaagtat
gctgaggagcgagaccgagctgaggctgaggcccgtgagaaggagacaaaggcactgtca
ctggcccgggcacttgaggaggccatggagcagaaggcagagctagaacggctcaacaag
cagttccgcacggagatggaggacctcatgagctccaaggatgacgtgggcaagagcgtc
catgagctggagaagtccaagagggcattggagcagcaggtcgaggagatgaagacccag
ctggaggagctggaggatgagcttcaggccactgaggatgccaagctccgtctggaggtg
aacctgcaggccatgaaggcccagtttgagcgggatctgcagggccgggatgaacagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcggagctggaggat
gagaggaagcagcggtccattgccatggctgctcgcaagaaactagagatggatctgaag
gacctggaggctcacatagacacagccaacaagaaccgggaggaggccatcaaacagcta
cggaagcttcaggcccagatgaaggactgcatgcgggagctggacgacacgcgagcctcc
cgggaggagatcctggcccaggccaaggagaatgagaagaagctcaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagccgccgagcgtgctaaacgccaggcccaa
caggagcgggatgagctggccgatgagatcgccaacagcagtggcaaaggggccctagca
ttggaggagaagcggcgactagaggcccgcattgcccagctggaggaagagctggaggag
gagcagggcaacacagaactgatcaacgaccggctgaagaaggccaatctgcagatcgac
caaataaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgcgcgg
cagcagctggaacgccagaacaaggagctcaaggccaagctgcaggagatggagagtgct
gtcaagtccaaatacaaggcctccatcgctgccttggaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctccaagcaggtgcgccgggcg
gagaagaagctgaaggatgtgctgctgcaagtggaagacgagcggaggaacgcggagcag
ttcaaggaccaggccgacaaggcatccactcgcctgaagcagcttaagcggcagctagag
gaggccgaggaggaggcccagcgggccaatgcctcccgccggaagctgcagcgtgagctg
gaggatgccacagagactgccgatgctatgaaccgagaggtcagctccctgaagaacaaa
ctgaggcgtggggacatgccatttgttgtgacccgccgaattgtccggaaaggcactggc
gactgctcagacgaggaggtcgacggtaaagcagacggggctgatgccaaggcagccgag
tag

DBGET integrated database retrieval system