KEGG   Rattus norvegicus (rat): 25745Help
Entry
25745             CDS       T01003                                 

Gene name
Myh9l1
Definition
(RefSeq) myosin, heavy chain 9, non-muscle-like 1
  KO
K10352  myosin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25745 (Myh9l1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25745 (Myh9l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25745 (Myh9l1)
   04147 Exosome [BR:rno04147]
    25745 (Myh9l1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25745 (Myh9l1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   25745 (Myh9l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ CC2-LZ ADIP AAA_22
Motif
Other DBs
NCBI-GeneID: 25745
NCBI-ProteinID: NP_037326
RGD: 3140
Ensembl: ENSRNOG00000004860
UniProt: G3V6P7
Position
7q34
AA seq 1960 aa AA seqDB search
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSTKNGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNS
IRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERACRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FSEGERVRTELADKVSKLQVELDSVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCL
ETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESA
VKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRAEKKLKDVLLQVEDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDMPFVVTRRIVRKGTGDCSDEEVDGKADGADAKAAE
NT seq 5883 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaggctgcagacaagtacctctatgtggataaaaacttcatcaataacccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccaccaagaatggc
tttgaaccagccagccttaaggaggaggtgggagaagaggccattgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgatatccagaagatgaacccacccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgatactactcagggctcatctatacctattcaggcctgttctgtgtggtc
attaatccttataagaacctgcctatctactcagaggagatcgtggacatgtacaagggc
aagaagaggcacgagatgccgccccacatctatgccatcacagacactgcctacaggagc
atgatgcaggaccgagaagatcagtccatcctttgcacgggtgagtctggagcaggcaag
acagagaacaccaagaaagtcatccagtacctggcacatgtggcctcctcacacaagagc
aagaaggaccagggggagctggagcgccaactgctgcaggccaaccctatcctagaggcc
tttggaaacgccaagacggtgaagaatgacaactcttcacgatttggtaaattcattcgt
atcaactttgatgtcaacggctacatcgttggggccaacattgagacttatcttctggag
aaatctcgtgctatccgccaagccaaggaggaaagaaccttccacattttctattacctg
ctgtctggggccggagagcacctgaagactgatctcctgttggagccatacaataaatac
cgcttcctgtccaatgggcatgtcaccatcccagggcagcaggacaaggacatgttccag
gagacaatggaggccatgaggattatgggtatcccagaggatgagcagatgggcttgctg
cgggtcatctctggcgtccttcagcttggcaacattgtcttcaagaaggaacggaacact
gaccaggcgtccatgccagataacacagctgctcaaaaggtgtcccacctcctggggatc
aatgtgaccgacttcaccagaggcatccttaccccgcgcatcaaggtgggcagagactat
gtgcagaaggcacagactaaagagcaggctgactttgccatcgaggctttggccaaggct
acctacgagcggatgttccgctggctggtgcttcgcattaacaaagctctggacaagacc
aagaggcagggcgcctcatttatcgggatcctggacatcgctggcttcgagatctttgat
ctgaactccttcgagcaactttgcatcaactataccaacgagaagctgcagcagctgttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgagagggcatcgagtggaac
ttcatcgactttggccttgacctgcagccttgcatcgacctcattgagaagccggcgggt
cccccaggcatcctggccctgttagatgaggaatgttggttccctaaagccactgacaag
agcttcgtggagaaggtggtgcaggagcagggcacccaccccaagttccagaagcccaag
caactgaaggacaaggctgatttctgcatcatccactatgcaggcaaggtggactataag
gccgatgagtggctgatgaagaacatggaccctctgaacgacaacattgccaccctgctt
caccagtcctcagacaagtttgtctctgagctgtggaaggatgtggatcgaatcattggc
ttggaccaggtggctggaatgtctgagacagcgctacccggtgccttcaagactcggaag
ggcatgttccgtactgtggggcagctgtacaaggagcagctggccaagctcatggccaca
ctgaggaataccaatcccaactttgtccgctgcatcattcccaaccacgagaagaaggcc
ggcaaactggacccacacctggtgctggaccagttacgctgcaatggcgtccttgaaggc
atccgaatctgccgccagggctttcccaacagagtggtcttccaggagttccggcagagg
tatgagatcctcacacctaactccattccgaagggcttcatggatgggaagcaggcgtgt
gtgctcatgatcaaagccttggagcttgacagcaacctgtaccgcatcggccagagcaaa
gtgttcttccgggccggagtcctagctcacctggaggaagagcgggacctgaagatcact
gatgtcatcattggcttccaggcctgctgcagaggctacctggccaggaaggcctttgcc
aagaggcagcagcagctgactgccatgaaggtcctacagaggaactgtgctgcatacctc
agactccgcaactggcagtggtggaggctcttcaccaaggtcaagcccctgctgaactca
ataaggcatgaggatgagcttttagccaaggaggcggaactgacaaaagttcgagagaag
catctggctgcagagaacaggctgacagagatggagactatgcagtctcagctcatggca
gagaagttgcagcttcaggagcagctgcaggcggaaacagagttgtgtgccgaggctgag
gagctccgggcccgcctgacagcgaagaagcaggagttggaggagatctgccatgacctg
gaggccagggtagaggaggaggaggagcgctgccagtatctgcaggcagagaagaagaag
atgcagcagaacatccaggaactcgaggagcagctggaggaggaggagagtgcccggcag
aagctgcagcttgagaaggtgaccactgaggccaagctgaagaaactggaggaggaccag
atcatcatggaggatcaaaactgcaaactggccaaggagaagaagctgctggaagacaga
gtagctgaatttactacaaacctcatggaagaggaggagaagtccaagagcctggccaaa
ctcaagaacaagcacgaggcgatgatcaccgacctggaagagcgccttcgtagggaggag
aagcaaaggcaggagttggagaagacccgccgcaagctagagggagactccacagacctc
agcgaccagattgctgagctccaggcgcagatcgcagagctcaagatgcagctggccaag
aaggaggaggaattgcaggctgccttggccagagtggaagaagaagctgctcagaagaac
atggccctgaagaagattcgagaactggaaactcagatctctgagctgcaggaagacctg
gagtcggagcgagcctgcaggaacaaagctgagaagcagaaacgggatcttggagaagag
ctagaggctctgaagacagagctggaggacactctggactccaccgctgcccagcaggaa
ctgaggtcaaagcgtgagcaggaagtgagcatcctgaagaagactcttgaggatgaggcc
aagacccatgaggcccagatccaggagatgaggcagaagcactcgcaggccgtggaggag
ctggccgagcaattggagcagactaagcgggtaaaagctacccttgagaaggcgaagcag
accctggagaatgagcggggagagctggccaatgaggtgaaggccttgctgcagggcaag
ggcgactcggagcacaagcgcaagaaggtggaggcgcagctgcaagaactgcaggtcaag
ttcagcgagggagagcgtgtacggaccgagctggctgacaaggtctccaagctgcaggtt
gaactggacagcgtgactggtctccttaaccagtcggacagcaagtccagcaagcttaca
aaggacttctctgcgctggagtcccagctccaggacacacaggagctgctccaggaggag
aaccggcagaagctgagcctcagcaccaagctcaagcagatggaggatgagaaaaactcc
ttcagagagcagctggaggaggaagaggaggccaagcgcaacctggagaagcagatcgcc
accctccatgcccaggtgactgatatgaagaagaagatggaggacggtgtagggtgcctg
gagacagcagaggaggcaaagcggaggcttcagaaggacctggaaggcctgagccagcgg
cttgaggagaaggtggctgcctatgataagctggagaagaccaagacccggcttcagcag
gagctggatgacctgctggtggacctggaccaccagcggcagagcgtctccaacctggaa
aagaagcagaagaagtttgaccagctcctagctgaggagaagaccatctcagccaagtat
gctgaggagcgagaccgagctgaggctgaggcccgtgagaaggagacaaaggcactgtca
ctggcccgggcacttgaggaggccatggagcagaaggcagagctagaacggctcaacaag
cagttccgcacggagatggaggacctcatgagctccaaggatgacgtgggcaagagcgtc
catgagctggagaagtccaagagggcattggagcagcaggtcgaggagatgaagacccag
ctggaggagctggaggatgagcttcaggccactgaggatgccaagctccgtctggaggtg
aacctgcaggccatgaaggcccagtttgagcgggatctgcagggccgggatgaacagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcggagctggaggat
gagaggaagcagcggtccattgccatggctgctcgcaagaaactagagatggatctgaag
gacctggaggctcacatagacacagccaacaagaaccgggaggaggccatcaaacagcta
cggaagcttcaggcccagatgaaggactgcatgcgggagctggacgacacgcgagcctcc
cgggaggagatcctggcccaggccaaggagaatgagaagaagctcaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagccgccgagcgtgctaaacgccaggcccaa
caggagcgggatgagctggccgatgagatcgccaacagcagtggcaaaggggccctagca
ttggaggagaagcggcgactagaggcccgcattgcccagctggaggaagagctggaggag
gagcagggcaacacagaactgatcaacgaccggctgaagaaggccaatctgcagatcgac
caaataaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgcgcgg
cagcagctggaacgccagaacaaggagctcaaggccaagctgcaggagatggagagtgct
gtcaagtccaaatacaaggcctccatcgctgccttggaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctccaagcaggtgcgccgggcg
gagaagaagctgaaggatgtgctgctgcaagtggaagacgagcggaggaacgcggagcag
ttcaaggaccaggccgacaaggcatccactcgcctgaagcagcttaagcggcagctagag
gaggccgaggaggaggcccagcgggccaatgcctcccgccggaagctgcagcgtgagctg
gaggatgccacagagactgccgatgctatgaaccgagaggtcagctccctgaagaacaaa
ctgaggcgtggggacatgccatttgttgtgacccgccgaattgtccggaaaggcactggc
gactgctcagacgaggaggtcgacggtaaagcagacggggctgatgccaaggcagccgag
tag

DBGET integrated database retrieval system