KEGG   Rattus norvegicus (rat): 25747
Entry
25747             CDS       T01003                                 

Gene name
Ppara
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04024  cAMP signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05160  Hepatitis C
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25747 (Ppara)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25747 (Ppara)
   04920 Adipocytokine signaling pathway
    25747 (Ppara)
   03320 PPAR signaling pathway
    25747 (Ppara)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    25747 (Ppara)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25747 (Ppara)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25747 (Ppara)
   04931 Insulin resistance
    25747 (Ppara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25747 (Ppara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25747 (Ppara)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    25747 (Ppara)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   25747 (Ppara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep Tautomerase
Other DBs
NCBI-GeneID: 25747
NCBI-ProteinID: NP_037328
RGD: 3369
Ensembl: ENSRNOG00000021463
UniProt: P37230
Position
7
AA seq 468 aa
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSLGEESSGSFSFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPAVPTSTDESPGNALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLAKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVENKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtggacacagagagccccatctgtcctctctccccacttgaagcagatgacctggaa
agtcccttatctgaagaattcttacaagagatgggaaacattcaagagatttctcagtcc
ctcggagaggagagttccggaagctttagttttgcggactaccagtacttagggagctgt
ccaggctcggagggctctgtcatcacagacaccctctctccagcttccagcccctcctca
gtcagctgccctgctgtccccaccagtacagatgagtcccctggcaatgcactgaacatc
gagtgtcgaatatgtggggacaaggcctcaggataccactatggagtccacgcatgtgaa
ggctgcaagggcttctttcggcgaactattcggctaaagctggcgtacgacaagtgtgat
cgaagctgcaagattcagaaaaagaaccggaacaaatgccagtactgccgtttccacaag
tgcctgtccgtcgggatgtcacacaatgcaatccgttttggaagaatgccaagatctgag
aaagcaaaactgaaggcagaaatccttacctgtgaacacgatctgaaagattcggaaact
gcagacctcaaatctctggccaagagaatccacgaagcctacctgaagaacttcaacatg
aacaaggtcaaggcccgggtcatactcgcaggaaagactagcaacaatccgccttttgtc
atacatgacatggagaccttgtgcatggctgagaagacgcttgtggccaagatggtagcc
aacggcgttgaaaacaaggaggcagaggtccgattcttccactgctgccagtgcatgtcc
gtggagaccgtcaccgagctcacggaatttgccaaggctatcccaggctttgcaaacttg
gacttgaatgaccaggttaccttgctgaagtacggtgtgtatgaagccatcttcacgatg
ctgtcctccttgatgaacaaagacgggatgctgatcgcgtacggcaatggcttcatcacc
cgagagttcctaaagaacctgaggaagccattctgcgacatcatggaacccaagtttgac
ttcgctatgaagttcaatgccctcgaactggatgacagtgacatttccctttttgtggct
gctataatttgctgtggagatcggcctggccttctaaacataggatacattgagaagttg
caggaggggattgtgcacgtgctcaagctccacctgcagagcaaccatccggatgatacc
tttctcttcccaaaactccttcaaaaaatggtggacctccggcagctggtcacggagcat
gcgcagctcgtgcaggtcatcaagaagaccgagtcagacgcggcgttgcacccactgttg
caagagatctacagagacatgtactga

DBGET integrated database retrieval system