KEGG   Rattus norvegicus (rat): 25750Help
Entry
25750             CDS       T01003                                 

Gene name
Maob
Definition
(RefSeq) monoamine oxidase B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00380  Tryptophan metabolism
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    25750 (Maob)
   00330 Arginine and proline metabolism
    25750 (Maob)
   00340 Histidine metabolism
    25750 (Maob)
   00350 Tyrosine metabolism
    25750 (Maob)
   00360 Phenylalanine metabolism
    25750 (Maob)
   00380 Tryptophan metabolism
    25750 (Maob)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    25750 (Maob)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    25750 (Maob)
   04726 Serotonergic synapse
    25750 (Maob)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    25750 (Maob)
   05031 Amphetamine addiction
    25750 (Maob)
   05034 Alcoholism
    25750 (Maob)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     25750 (Maob)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 FAD_oxidored FAD_binding_3 DAO Pyr_redox_2 Thi4 Pyr_redox_3 Pyr_redox AlaDh_PNT_C HI0933_like GIDA Lycopene_cycl MCRA
Motif
Other DBs
NCBI-GeneID: 25750
NCBI-ProteinID: NP_037330
RGD: 3041
Ensembl: ENSRNOG00000029778
UniProt: P19643
Position
Xq11
AA seq 520 aa AA seqDB search
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDCVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDAGCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatgcgatgtgatcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttttgcatgactgtggcctcagtgtggtggttctggaagcacgagactgtgtggga
ggcaggacttacacaattaggaataaaaatgttaaatatgtggaccttggaggatcttat
gttgggccgacccagaatcgtatcttacgattggccaaagagctaggattggagacctat
aaagtgaatgaagttgagcggctgatccactttgtaaagggaaaatcatatgccttcagg
ggcccattcccaccagtgtggaatccaatcacttacctagattataacaacctctggaga
acaatggatgagatgggccaagagattcccagtgatgctccatggaaggcaccccttgct
gaagagtgggactacatgacaatgaaagagttgctagataagatctgctggaccaactct
acaaagcagattgccacactctttgtgaacctatgtgtaactgcggagacccatgaggtt
tctgcactgtggttcctgtggtatgtgaagcagtgtgggggtacaaccagaatcatatca
acaaccaatggaggacaggagaggaaatttattggtggatctggtcaagtgagtgagcgg
ataaaggatatccttggggacagagtgaagctggagaggccggtgatccacattgaccag
acaggagaaaatgttgttgtgaaaaccctaaaccatgaaatatatgaggctaaatatgtg
attagtgccatcccacctgttttgggcatgaagattcaccatagtcctcctctgcccatt
ctaagaaaccagctgattactcgtgtgcctttgggttcagttattaagtgcatggtttat
tataaagaacccttctggaggaaaaaggatttctgtggaaccatggttattgaaggagag
gaagctccaattgcgtacacattggatgataccaagccagatgcaggctgtgctgctata
atgggatttatccttgctcacaaagctagaaaactggtacgccttactaaagaagaaaga
ctgaggaagctctgtgagctatacgcgaaagttctgaactctcaagaagctctgcagcca
gtccattatgaagagaagaactggtgtgaggagcagtactccgggggctgctacacagcc
tacttccctcctggcatcttgacccagtatggaagggttctacgccagccagtgggcaag
attttctttgcaggcaccgagacagcttcacattggagtggctacatggagggggctgta
gaggctggagagagagctgccagagagattcttcatgccattgggaagattccagaggat
gaaatttggcagccagaaccagaatctgtggatgtcccagcaagacccattaccaacacc
ttcctggagagacacttgccttctgtaccaggtctactaaagctgcttggattgaccacc
atcttgtcagcaacagctcttggtttcctggcccacaaaaagggtctgtttgtacgtttc
taa

DBGET integrated database retrieval system