KEGG   Rattus norvegicus (rat): 25751Help
Entry
25751             CDS       T01003                                 

Gene name
Dnm2, DYIIAAB
Definition
(RefSeq) dynamin 2
  KO
K23484  dynamin 2 [EC:3.6.5.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04666  Fc gamma R-mediated phagocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    25751 (Dnm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25751 (Dnm2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    25751 (Dnm2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    25751 (Dnm2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25751 (Dnm2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    25751 (Dnm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25751 (Dnm2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     25751 (Dnm2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    25751 (Dnm2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    25751 (Dnm2)
   RhoA-dependent endocytosis
    25751 (Dnm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 PH_11
Motif
Other DBs
NCBI-GeneID: 25751
NCBI-ProteinID: NP_037331
RGD: 2513
Ensembl: ENSRNOG00000007649
UniProt: P39052
Position
8q13
AA seq 870 aa AA seqDB search
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGRKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAEQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSSHSPTPQRRPVSSVHPPGR
PPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQNVFANNDPFSAPPQIPSRPARIPP
GIPPGVPSRRAPAAPSRPTIIRPAEPSLLD
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctcatcccgctggttaacaagctgcaggacgccttc
agctccatcggtcagagctgccacctggacctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagttcggtgctcgagaacttcgtgggccgggacttccttccacgagga
tcaggaattgtcacccggaggcctctcattctgcagctcatcttttccaaaacagaatat
gcggagtttttgcactgcaagtccaaaaagtttacagactttgatgaagtccggcaggag
atcgaagcagagactgaccgggtcacaggcaccaacaaaggcatctccccggtgcccatc
aaccttcgggtctattcaccacacgtgttgaacttgaccctcatcgacctcccaggcatc
actaaggtgccagttggggaccagccaccagacatcgagtaccagatcaaggacatgatc
ctgcagtttatcagccgggagagcagcctcattcttgccgtcacacctgccaacatggac
ttggccaactcggatgccctcaagctggccaaggaggtggacccccaaggcttgcggacc
attggtgtcatcaccaagctagacctgatggatgaaggcacagatgccagggatgtcctg
gagaacaagctcctgcccttgagaagaggctacatcggcgtggttaaccgcagccagaaa
gacatcgagggcagaaaggacatccgggcagctctggcagctgagaggaaattcttcctc
tcccacccagcctaccggcacatggctgaccgcatgggtaccccacacttgcagaaaaca
ctgaaccagcaactgaccaaccacatccgggagtcactgccaaccctgcgcagcaagctg
cagagccaactgctgtccctggagaaggaagtggaagagtacaagaatttccggcctgac
gaccccacacgcaagaccaaagccctgctgcagatggtccagcagtttggagtggacttt
gagaagcgaatcgaaggctctggagatcaagtcgacaccctggagctgtctgggggcgcc
cgcatcaatcgcatcttccacgagcgctttccctttgagctggtgaagatggagtttgac
gagaaagacctccgaagagagatcagctacgccattaagaacatccacggagtcagaact
gggctcttcacgccggatttggcgttcgaggccattgtgaaaaagcaggtggtcaagctg
aaagagccctgtctgaaatgcgtggacctggttatccaggagctaatcagtacagttagg
caatgcaccagcaagctcagttcctacccccgccttcgagaggagaccgaacgcattgtc
accacctacatcagggagcgagaagggagaaccaaggaccagatccttcttctgattgac
attgagcagtcctacatcaacacaaaccatgaagacttcattggatttgccaatgcccag
cagaggagcacgcagctgaacaagaagagggccatacctaaccagggggagatcttggtg
atccgcaggggctggttgaccatcaacaacatcagcttgatgaaaggcggttccaaggag
tactggttcgtgctgactgctgagtcgttgtcttggtacaaggatgaagaggaaaaagaa
aagaagtacatgctgccactagacaacctcaaaatacgggatgtggagaagggcttcatg
tccaacaagcatgtgtttgccatcttcaacacagagcagaggaacgtctacaaggacctg
cgacagatcgaactggcttgtgactcccaggaagatgtggacagctggaaggcttcgttc
ctgcgagctggggtctacccagagaaggaccaggcagagaacgaggatggagcacaagag
aacaccttctccatggacccgcagctggagcggcaggtggagaccatccgcaacttggtg
gactcctatgtggccatcatcaacaagtccatccgggacctcatgccaaagaccatcatg
cacctcatgatcaacaacacaaaggccttcatccaccatgagctgctagcctacctgtac
tcatcagcagaccagagcagcctcatggaggagtcagctgagcaggctcagcggcgggac
gatatgctgcgcatgtaccatgcactcaaggaagcgctcaacatcattggggacatcagc
accagcaccgtgtccacgcctgtgcccccacctgtcgatgatacttggctccagaacacc
agcagccacagccccactccacagcgcagacctgtgtccagtgtgcacccgccgggccgc
ccacccgcagtgcggggccccacaccggggcctcccctcattcctatgcctgtgggggcc
acatcctccttctcggcaccccccatcccatcccggcctggaccacagaatgtgtttgcc
aacaatgaccccttctctgcgccacctcagataccgtctcggccagcacggattccccct
gggatccctccaggagtgcccagcagaagagcgcccgctgcgcccagccggcccaccatt
atccgcccagccgagccgtccctgctcgactag

DBGET integrated database retrieval system