KEGG   Rattus norvegicus (rat): 25752Help
Entry
25752             CDS       T01003                                 

Gene name
Cd6, OX52
Definition
(RefSeq) Cd6 molecule
  KO
K06456  T-cell surface glycoprotein CD6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25752 (Cd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25752 (Cd6)
CD molecules [BR:rno04090]
 Proteins
  25752 (Cd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR SRCR_2 DAG1
Motif
Other DBs
NCBI-GeneID: 25752
NCBI-ProteinID: NP_783167
RGD: 2312
Ensembl: ENSRNOG00000020884
UniProt: G3V8U0 Q5FVU4 Q812A4
Position
1q43
AA seq 665 aa AA seqDB search
MWLFLGIAGLLTAVLSGLPPPAPSDQHRNGSIPNMSSDPEEQLGIRLVNGSSRCSGFVQV
LLESWEPVCAGHWNRAATEAACNALGCGDLGNFTHLAPPTSERPPGATSRNTSSSRNTTW
AGAPTVRCHGANWQLCKVEDYECSSDRRLVWVTCAENQAVRLVDGGSRCAGRVEMLQHGE
WGTVCDDTWDLDDANVVCKQLKCGWAVKALAGLHFTPGQGPIHRDQVNCSGTEAYLWDCP
GRPGDQYCGHKEDAGVVCSEHQSWRLTGGVDSCEGQVEVYFRGVWSTVCDSEWYPSEAKV
LCQSLGCGSEVDRPKGLPHSLAGRMYYSCKGEELTLSTCSWRFNNSNLCSQSLAARVVCS
GSQRHPNLSTSEVPSRVPVTIESSVPVSVKDKDSQNLTLLIPCIVLGILLLVSLIFIVFL
LLKAKGQYALPTSVNHQQLSTANPAGINNYHPVPITIAKEAPMLFIKPRVPEDSDSSSES
DYEHYDFSSQPPVALTTFYNSQRHRVTEEEAQQNRFRMPPLEEGLEELHVSNIPAADPRP
CVVDAPSLGSQYHTRNNSDSSTSSEEGYCNDPSSKPPPWNSQVFSEKSPLTEQPPNLELA
GSQAMFSAGASADDSSSTSSGEWYQNFQPPPQHPPVEQFECPGPPDLQADSIDDDEEDYD
DIGAA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttccttgggatcgctggattgctgacagcagttctctcaggtctcccacct
ccagccccctctgaccagcacagaaatggcagcatcccaaatatgtcctcggacccagag
gagcagctggggattcgcctggtgaacgggagcagtcgctgcagtggatttgtgcaggtt
cttctagagtcctgggagcctgtgtgtgcagggcactggaatcgggctgctacagaggct
gcatgcaacgcactgggctgtggcgatttgggaaactttacccacctggcgccacccacc
tctgagcgtccaccaggagccacttcccggaacactagcagctccaggaatacgacatgg
gcgggggcaccaactgtgagatgccacggagccaattggcaactctgcaaggtggaggac
tacgagtgcagcagcgacaggcggctggtgtgggtcacctgtgcagagaaccaggctgtg
cggttagtggatggtggcagtcgctgcgctggccgcgtggagatgctgcagcatggtgaa
tggggaacagtgtgcgatgacacgtgggacctggatgatgcaaacgtagtgtgtaagcag
ctgaagtgtggctgggcagtgaaggcactggccggcttgcacttcaccccaggccaagga
cccatccaccgtgaccaagtgaactgctctgggaccgaggcctatctgtgggactgcccg
gggcggccaggagaccagtactgcggtcacaaggaggatgcaggagtggtgtgctcagag
caccagtcctggcgcctgactggaggtgttgactcctgcgaagggcaagtggaagtgtac
ttccggggtgtctggagcaccgtgtgtgacagcgaatggtacccatccgaggccaaagtg
ctctgtcagtccttgggttgtggatcagaagtggaccggcccaaggggctgccacactcc
ctggcaggcagaatgtactactcctgtaaaggggaggagctcaccctcagcacctgctcc
tggcggttcaacaattccaacttgtgcagccagtcgctggccgcaagggttgtctgctca
ggctcccagagacatcccaatctgtcgacttctgaagtgccttccagagttccggtcacc
atagaatcttctgtgcctgtgagcgtgaaggataaggactctcaaaatttgacacttctc
attccctgcattgtcctgggaattctccttcttgtctccctcatcttcatagtttttctt
ctcttgaaagccaaaggacaatatgccctccctacttcagtgaaccaccagcaactgtcc
actgccaatccagcagggatcaacaactaccatcctgtccctatcaccattgccaaagaa
gctcctatgttgttcatcaagccccgggtccccgaggactcggactccagttctgaatcc
gactatgagcattatgacttcagctcccagccgcctgtggccctgaccaccttctacaat
tcccagaggcaccgggtcacagaggaagaagcccaacagaacaggttccggatgccaccc
ttggaggaaggacttgaagagttgcacgtttctaacatcccagctgctgaccccagaccc
tgtgtggtggatgccccctctctgggctctcagtaccacacgaggaacaacagtgactcc
agcacatcctctgaggagggttactgcaatgatcccagcagcaagccacctccatggaac
tcccaggtgttttccgagaagagtcccctcacagagcagccccccaacttggaactggct
ggctctcaggcaatgttttcagcaggggcctcggccgatgacagctccagtacctcgtct
ggggagtggtaccagaacttccagccaccaccccagcatcctccagtggaacagtttgaa
tgtccaggaccgcctgacctccaagcagactccattgatgatgatgaggaagactacgat
gacattggagcagcctag

DBGET integrated database retrieval system