KEGG   Rattus norvegicus (rat): 25753
Entry
25753             CDS       T01003                                 

Gene name
Chrng, ACHRG
Definition
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25753 (Chrng)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25753 (Chrng)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   25753 (Chrng)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 25753
NCBI-ProteinID: NP_062018
RGD: 2354
UniProt: P18916
Position
9q35
AA seq 519 aa
MHGGQGPQLLLLLLATCLGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWQPDIVLGNNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSSCSISVTYFPFDWQNCSLVFQSQTYSTSEINL
QLSQEDGQAIEWIFIDPEAFTENGEWAIRHRPAKMLLDPVTPAEEAGHQKVVFYLLIQRK
PLFYVINIIVPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLMVVTILIVVNSVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVH
PRAPAAVQDARLRLQNGSSSGWPIMTREEGDLCLPRSELLFRQRQRNGLVQAVLEKLENG
PEMRQSQEFCGSLKQASPAIQACVDACNLMARARHQQSHFDSGNEEWLLVGRVLDRVCFL
AMLSLFICGTAGIFLMAHYNQVPDLPFPGDPRPYLPLPD
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcacgggggccagggacctcagctcctcttgctgctgctggctacctgcctgggggcc
cagagccgcaaccaagaggagcggctgcttgcggacctgatgcgcaactacgacccccat
ctgcggccggctgagcgtgactcagatgtggttaatgtcagcctgaagcttaccttaacc
aacctcatctcccttaatgagcgagaggaggccctcacgactaatgtctggatagaaatg
caatggtgcgactatcgcctacgctgggacccgaaagactacgaaggcctgtggatattg
agggtgccatctaccatggtctggcagcccgatatcgtgctgggaaacaatgtggacggt
gtcttcgaggtggcgctctactgcaatgtgctcgtgtcccctgatggttgtatctactgg
ctgccgcctgccatcttccgctcctcctgctccatctctgtcacctacttccccttcgat
tggcagaactgctccctcgtcttccagtcccagacttacagcaccagcgagatcaacttg
cagctgagccaggaggatgggcaagccattgagtggatcttcattgaccccgaggctttc
acagagaatggggaatgggccatccggcatcgaccagccaaaatgctactggatcctgtg
actccagcagaggaggcaggccaccagaaggtggtgttctacctgctcatccaacgcaag
cccctcttctatgtcatcaacatcatcgtcccctgtgtgctcatctcctcagttgcgatc
ctcatctacttccttcctgccaaggcgggcggccagaagtgcacagtggccaccaacgtg
ctcctggcccagaccgtcttccttttcctcgtggctaagaaggtgcctgagacctcccag
gcagtgccgctcatcagcaagtacctgaccttcctcatggtggtgaccatcctcatcgtt
gtgaactctgtggtcgtgctcaatgtgtccttgaggtccccacacacacactccatggcc
cggggggtccgcaaggtgtttttgaggctcctgccccagctgttacggatgcatgtgcat
cctcgggctcctgctgctgtccaggatgcccggctgcgactccagaatggctcttcctca
gggtggcccatcatgactcgagaggaaggggacctctgtttgcctcgaagcgaactcctc
tttaggcaaaggcagcgcaatggattggtgcaggcagtactggagaagttagagaatggt
ccagaaatgaggcagagccaggagttctgtggcagcctgaagcaagcctccccggccatc
caggcctgtgtggatgcctgtaacctcatggcgcgtgcccgacaccagcaaagtcacttt
gacagtgggaatgaggagtggttgctggtgggccgagtgctggaccgagtctgtttccta
gccatgctctccctcttcatctgcggcactgctggcatcttcctcatggcccactacaac
caggtgcctgacctgccattccctggagacccccgcccctacttgcctttgccagactga

DBGET integrated database retrieval system