KEGG   Rattus norvegicus (rat): 25756Help
Entry
25756             CDS       T01003                                 

Gene name
Cpt1b, CPT-IB, M-CPTI
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25756 (Cpt1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25756 (Cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25756 (Cpt1b)
   04920 Adipocytokine signaling pathway
    25756 (Cpt1b)
   03320 PPAR signaling pathway
    25756 (Cpt1b)
  09159 Environmental adaptation
   04714 Thermogenesis
    25756 (Cpt1b)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25756 (Cpt1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25756 (Cpt1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     25756 (Cpt1b)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    25756 (Cpt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 25756
NCBI-ProteinID: NP_037332
RGD: 2397
Ensembl: ENSRNOG00000010438
UniProt: O70253
Position
7q34
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG
IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRSPIMVDSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL
EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA
LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI
IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVRAMMTGSHKEQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY
GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcacaccaggcagtagctttccagttcactgtgaccccagacggggtcgac
ttccggcttagtcgggaggctctgagacacatctacctgtctggaatcaactcctggaag
aaacgccttattcgaatcaagaatggtatccttaggggtgtgtaccctggcagccctacc
agctggctggttgttgtcatggcaacagttggttccaactactgcaaagtggacatctcc
atggggctggtccattgcatccagagatgcctcccgacaaggtatggctcctacgggacc
ccacagaccgagacacttctcagtatggtcatcttctccaccggagtctgggcgacaggc
atttttttattccgacaaaccctgaagctgctgctttcctatcatgggtggatgttcgag
atgcacagcaagaccagccatgccaccaagatctgggctatctgtgttcgtctcctgtcc
agccggcggcccatgctctatagcttccaaacatcactgcccaagcttcctgtccccagt
gtgccagccacaattcaccggtacttggattctgtgcggcccttgctggatgacgaagcc
tatttccgcatggagtcgttggccaaagaattccaggacaagattgcccccagactgcag
aaatacctggtgctgaagtcatggtgggcaaccaactatgtaagtgactggtgggaagag
tacgtctacctccgaggcaggagccccatcatggtggacagcaactattacgccatggat
tttgtgcttattaagaacacgagccaacaagcagcacgtttgggaaacaccgttcacgcc
atgatcatgtatcgccgcaaactggaccgagaagagatcaagccggtgatggcactgggt
atggtacccatgtgctcctaccagatggagaggatgttcaacactacacgcatcccaggc
aaagagacagacttgctacagcacctctcagagagcaggcacgtggctgtctaccacaaa
ggtcgcttcttcaaggtttggctctatgagggctcgtgcctgctcaagccccgagacctc
gagatgcagttccagagaatcctcgatgacacctccccgcctcagcctggagaggaaaag
ctggcagccctcaccgcaggaggaagggtagagtgggcagaagcacgtcagaagttcttt
agctctggcaagaacaagatgtccctggataccatcgaacgtgctgctttctttgtggcc
ctggacgaagactctcactgttacaaccctgatgacgaggccagtctcagcctctacggc
aaatccctgctgcacggcaactgctataacaggtggttcgacaaatctttcactctcatc
tcctgcaagaatggccagctgggcctcaacacagaacactcatgggcagatgctcccatc
atcggtcacctctgggagttcgtcctggccactgatacctttcacctgggctacacggag
acaggacactgtgtgggtgaacccaacaccaagttgccgccgcctcagcggatgcagtgg
gacattcccgagcagtgccagacagccatcgagaattcgtaccaagtagccaaggccctg
gctgatgatgtggagttatactgcttccagttcttacccttcggcaaaggcctgatcaag
aagtgtcggaccagccctgatgcctttgtgcagattgccctgcagctggctcatttccgg
gacaaaggcaagttctgcctgacctatgaggcctccatgacaagaatgttccgagagggg
cggacagagactgtgcgttcctgtactagcgagtccacggcctttgtgcgggccatgatg
acggggtcccataaggaacaagacctccaagacctcttccggaaagcctccgaaaaacac
caaaacatgtaccgcctagccatgacaggggctgggatcgacaggcacctcttctgcctc
tacatcgtctccaagtacttaggggttaggtctcctttcctggacgaggtgctttcggaa
ccctggagcctctccaccagccagatcccccagttccagatctgcatgtttgacccaaag
cagtaccccaatcatctgggtgctggaggtggctttggtcctgtggccgaccacggatac
ggggtttcctacatgatcgcaggcgaaaacacaatgttcttccatgtttccagcaagtta
tcgagttcagaaacgaacgccctgcgcttcgggaaccacatccgtcaagcactgttggat
atcgccgaccttttcaaaatttccaagactgacagctga

DBGET integrated database retrieval system