KEGG   Rattus norvegicus (rat): 25756
Entry
25756             CDS       T01003                                 

Gene name
Cpt1b
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25756 (Cpt1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25756 (Cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25756 (Cpt1b)
   04920 Adipocytokine signaling pathway
    25756 (Cpt1b)
   03320 PPAR signaling pathway
    25756 (Cpt1b)
  09159 Environmental adaptation
   04714 Thermogenesis
    25756 (Cpt1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25756 (Cpt1b)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25756 (Cpt1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25756 (Cpt1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     25756 (Cpt1b)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    25756 (Cpt1b)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Other DBs
NCBI-GeneID: 25756
NCBI-ProteinID: NP_037332
RGD: 2397
Ensembl: ENSRNOG00000010438
UniProt: Q63704 O70253
Position
7
AA seq 772 aa
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG
IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRSPIMVNSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL
EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA
LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI
IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVRAMMTGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY
GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcggaagcacaccaggcagtagctttccagttcactgtgaccccagacggggtcgac
ttccggcttagtcgggaggctctgagacacatctacctgtctggaatcaactcctggaag
aaacgccttattcgaatcaagaatggtatccttaggggtgtgtaccctggcagccctacc
agctggctggttgttgtcatggcaacagttggttccaactactgcaaagtggacatctcc
atggggctggtccattgcatccagagatgcctcccgacaaggtatggctcctacgggacc
ccacagaccgagacacttctcagtatggtcatcttctccaccggagtctgggcgacaggc
atttttttattccgacaaaccctgaagctgctgctttcctatcatgggtggatgttcgag
atgcacagcaagaccagccatgccaccaagatctgggctatctgtgttcgtctcctgtcc
agccggcggcccatgctctatagcttccaaacatcactgcccaagcttcctgtccccagt
gtgccagccacaattcaccggtacttggattctgtgcggcccttgctggatgacgaagcc
tatttccgcatggagtcgttggccaaagaattccaggacaagattgcccccagactgcag
aaatacctggtgctgaagtcatggtgggcaaccaactatgtaagtgactggtgggaagag
tacgtctacctccgaggcaggagccccatcatggtgaacagcaactattacgccatggat
tttgtgcttattaagaacacgagccaacaagcagcacgtttgggaaacaccgttcacgcc
atgatcatgtatcgccgcaaactggaccgagaagagatcaagccggtaatggcactgggt
atggtacccatgtgctcctaccagatggagaggatgttcaacactacacgcatcccaggc
aaagagacagacttgctacagcacctctcagagagcaggcacgtggctgtctaccacaaa
ggtcgcttcttcaaggtttggctctatgagggctcgtgcctgctcaagccccgagacctc
gagatgcagttccagagaatcctcgatgacacctccccgcctcagcctggagaggaaaag
ctggcagccctcaccgcaggaggaagggtagagtgggcagaagcacgtcagaagttcttt
agctctggcaagaacaagatgtccctggataccatcgaacgtgctgctttctttgtggcc
ctggacgaagactctcactgttacaaccctgatgacgaggccagtctcagcctctacggc
aaatccctgctgcacggcaactgctataacaggtggttcgacaaatctttcactctcatc
tcctgcaagaatggccagctgggcctcaacacagaacactcatgggcagatgctcccatc
atcggtcacctctgggagttcgtcctggccactgatacctttcacctgggctacacggag
acaggacactgtgtgggtgaacccaacaccaagttgccgccgcctcagcggatgcagtgg
gacattcccgagcagtgccagacagccatcgagaattcgtaccaagtagccaaggccctg
gctgatgatgtggagttatactgcttccagttcttacccttcggcaaaggcctgatcaag
aagtgtcggaccagccctgatgcctttgtgcagattgccctgcagctggctcatttccgg
gacaaaggcaagttctgcctgacctatgaggcctccatgacaagaatgttccgagagggg
cggacagagactgtgcgttcctgtactagcgagtccacggcctttgtgcgggccatgatg
acggggtcccataagaaacaagacctccaagacctcttccggaaagcctccgaaaaacac
caaaacatgtaccgcctagccatgacaggggctgggatcgacaggcacctcttctgcctc
tacatcgtctccaagtacttaggggttagatctcctttcctggacgaggtgctttcggaa
ccctggagcctctccaccagccagatcccccagttccagatctgcatgtttgacccaaag
cagtaccccaatcatctgggtgctggaggtggctttggtcctgtggccgaccacggatac
ggggtttcctacatgatcgcaggcgaaaacacaatgttcttccatgtttccagcaagtta
tcgagttcagaaacgaacgccctgcgcttcgggaaccacatccgtcaagcactgctggat
atcgccgaccttttcaaaatttccaagactgacagctga

KEGG   Rattus norvegicus (rat): 25757
Entry
25757             CDS       T01003                                 

Gene name
Cpt1a
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25757 (Cpt1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25757 (Cpt1a)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25757 (Cpt1a)
   04920 Adipocytokine signaling pathway
    25757 (Cpt1a)
   03320 PPAR signaling pathway
    25757 (Cpt1a)
  09159 Environmental adaptation
   04714 Thermogenesis
    25757 (Cpt1a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25757 (Cpt1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25757 (Cpt1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     25757 (Cpt1a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    25757 (Cpt1a)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N tRNA-synt_1g
Other DBs
NCBI-GeneID: 25757
NCBI-ProteinID: NP_113747
RGD: 2396
Ensembl: ENSRNOG00000014254
UniProt: P32198
Position
1
AA seq 773 aa
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPS
SWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPV
VGHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLL
ANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggcagaggctcaccaagctgtggccttccagttcactgtcacccccgatggcattgac
ctccgcctgagccacgaagccctcaaacagatctgcctgtcggggctgcactcctggaag
aagaagttcatccggttcaagaatggcatcatcactggtgtgttccccgcgaatccgtcc
agctggcttatcgtggtggtgggtgtgatttcatccatgcatgccaaagtggacccctcc
ctgggcatgatcgcaaagatcagtcggaccctagacaccactggccgaatgtcaagccag
acgaagaacattgtgagcggcgtcctctttggtacagggctctgggtggcagtcatcatg
accatgcgctactcgctgaaggtgctgctctcctaccacggctggatgtttgcagaacac
ggcaaaatgagccgcagcaccaagatctggatggctatggtcaaggtcctctcaggtcgg
aagcccatgttgtacagcttccagacgtctctgccacgcctgcctgtcccagctgtcaaa
gatactgtgagcaggtacctggaatctgtgaggccactgatgaaggaagaagacttccag
cgcatgacagcactggcccaggattttgctgtcaacctcggacccaaattgcagtggtat
ttgaagctaaaatcctggtgggccacaaattacgtgagtgactggtgggaagaatatatc
tacctgcggggccgagggccgctcatggtcaacagcaactactacgccatggagatgctg
tacatcaccccaacccatatccaggcagcgagagctggcaacaccatccacgccatactg
ctgtatcgtcgcacattagaccgtgaggaactcaaacccattcgtcttctgggatccacc
attccactctgctcggcccagtgggagcgactcttcaatacttcccggatccctggggaa
gagacagacaccatccaacatatcaaggacagcaggcacattgttgtgtaccacagaggg
cggtacttcaaggtctggctctaccacgatgggaggctgctgaggccccgagagctggag
cagcagatgcagcagatcctggatgatccctcagagccacagcctggggaggccaagctg
gccgccctcactgctgcagacagagtgccctgggcaaagtgtcggcagacctattttgca
cgagggaaaaataagcagtccctggatgcggtggaaaaggcagcgttcttcgtgacgttg
gacgaatcggagcagggatacagagaggaggatcctgaggcatccatcgacagctacgcc
aaatccctgctgcatggaagatgctttgacaggtggtttgacaagtccatcacctttgtt
gtcttcaaaaacagcaagataggcataaatgcagagcactcctgggcggacgcgcccgtc
gtgggccatttgtgggagtatgtcatggccaccgacgtcttccagctgggttactcagag
gatggacactgtaaaggagacaccaaccccaacatccctaagcccacaaggctacaatgg
gacattccaggagagtgccaggaggtcatagatgcatccctgagcagcgccagtcttttg
gcaaatgatgtggacctgcattccttcccatttgactctttcggcaaaggcttgatcaag
aagtgccggacgagtcccgatgccttcatccagctggcgctgcagctcgcacattacaag
gacatgggcaagttctgcctcacatatgaggcctccatgacccggctcttccgagaaggg
aggacagagactgtacgctcctgcactatggagtcctgcaactttgtgcaggccatgatg
gaccccaagtcaacggcagagcagaggctcaagctgttcaagatagcttgtgagaagcac
cagcacctgtaccgcctcgccatgacgggcgccggcatcgaccgccatctcttctgcctc
tatgtggtgtccaagtatcttgcagtcgactcacctttcctgaaggaggtattgtctgag
ccatggaggttgtctacgagccagactcctcagcagcaggtggagctctttgactttgag
aaaaaccctgactatgtgtcctgtggagggggctttgggccggttgccgatgacggctat
ggtgtctcctacattatagtgggagagaattttatccacttccatatttcttccaagttc
tctagccctgagacagactcacaccgctttgggaagcacttgagacaagccatgatggac
attatcaccttgtttggcctcaccatcaattctaaaaagtaa

KEGG   Rattus norvegicus (rat): 308579
Entry
308579            CDS       T01003                                 

Gene name
Cpt1c
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    308579 (Cpt1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    308579 (Cpt1c)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    308579 (Cpt1c)
   04920 Adipocytokine signaling pathway
    308579 (Cpt1c)
   03320 PPAR signaling pathway
    308579 (Cpt1c)
  09159 Environmental adaptation
   04714 Thermogenesis
    308579 (Cpt1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    308579 (Cpt1c)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     308579 (Cpt1c)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    308579 (Cpt1c)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 308579
NCBI-ProteinID: NP_001030097
RGD: 1305384
Ensembl: ENSRNOG00000026163
UniProt: F1LN46 Q3KR63
Position
1
AA seq 801 aa
MAEAHQASSLLSSLSSDGAEVELSSSVWQEIYLSALRSWKRNLWRVWNDFLAGVVPATPL
SWLFLFSTIQLACLLQLDPSLGLMEKIKELLPDWGGQHHQLQGLLAAAVFASCLWGTLIF
TLHVALRLLLSHHGWLLEPHGTMSSPTKTWLALVRIFSGRHPRLFSFQRALPRQPVPGAQ
ETVRKYLESMRPVLRDDAFDSVVALANDFLRLQAPRLQLYLQLKSWCASNYVSDWWEEFV
YLRSRGSLVNSTYYMMDFLYVTPTPLQAARAGNAVHTLLLYRHLLNRQEIPPTLLMGMRP
LCSAQYERMFNTTRIPGVEKDYLCHLQDSQHVAVFHQGRFFRVGTHSSNGLLSPRALEQQ
FQYILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAATALETVEGAAFFVSLDSEP
AGLTRENPAASLDTYAHTLLTGQGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPVAGHL
WEFTLATECFQLGYATDGHCKGHPDPALPKPQRLQWDLPKQIQPSISLALRGAKTLSGNI
DCHVFPFFHFGKSFIKGCHVSSDSFIQLVLQLAHFRDRGQFCLTYESAMTRLFLEGRTET
VRSCTREACQFVRAMENKERTDQQCLALFREAVDKHQALLKAAMSGQGIDRHLFALYIMS
RLLHMQSPFLTQVQSQQWLLSTSQIPVQQTHLFDVHNYPDYVSSGGGFGPAHDHGYGVSY
IFMGENAISFHISSKQSSTETDSHRLGQHIEDALLDVASLFQAGQQFKRQFTGLGESSGW
KYSNLSCKTVDPNIPKSSTNL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggctgaggcacaccaggcctcgagcttgctgtcttcactcagttccgacggggcagaa
gtggagctcagctcctcagtgtggcaggagatttacctctctgccctacgctcctggaaa
aggaatctctggcgtgtctggaatgactttcttgctggtgtggtcccggcaacgcccctc
agctggcttttcctcttcagtacaatccagcttgcttgtctcctccagctggacccttcc
ctaggactgatggagaagattaaagagttgctgccagactggggcggacagcaccaccag
ctccaggggctcctggcagcagcagtctttgcctcgtgtttgtggggaaccctgatcttc
acacttcatgtggctctgaggctcctgctgtcccaccacggctggcttctggaacctcat
ggcaccatgtcctcacccacgaagacctggctggcattggtcagaatcttttcggggagg
cacccgaggctcttcagctttcaacgtgcgctcccgcggcagccagtgcccggagcgcaa
gagaccgtgcgcaagtacctagagtccatgcgccctgtgctccgagacgacgctttcgac
agcgttgtggcgctggcaaacgacttcctgaggttgcaggcgccacgactccagctctat
ttgcaactcaagtcctggtgcgcttccaactacgtcagcgactggtgggaagagtttgtg
tacctgcgttctcgaggctcgctggttaatagcacctactacatgatggattttctgtat
gtcacccccacaccactgcaggcagcccgtgcgggcaatgccgtgcataccctgctcctg
tatcgccaccttctgaaccggcaggagatcccaccgaccttgctgatggggatgcgcccc
ttgtgctccgcccagtacgagaggatgttcaacactacacggattccaggggtggaaaaa
gactacctttgtcacctccaagacagccaacatgtggctgtcttccaccagggcagattc
ttccgtgtagggacccactcttccaatggcctgctgtccccacgggccctggaacagcag
ttccagtacatcctggatgacccctccccagcctgtccccttgaggaacatctagctgct
ttgactgccgctcccaggagtatgtgggcccaggtacgtgagtctgtgaagacccatgcg
gccactgccctggagactgtggaaggggctgccttctttgtgtccctggattctgagccc
gcgggactgaccagagagaaccccgcagcttccctggacacctatgcccacactctgctg
actggccaaggccatgaccgttggtttgacaaatccttcaccctcatcgtcttctccaac
gggaagctgggcctcagcgtggagcactcatgggctgactgccctgtcgcgggacattta
tgggagttcaccctggccacagagtgcttccagttgggatatgccacagatggccactgt
aaggggcaccccgaccctgccctgccgaagccccagcgcctgcagtgggaccttccaaag
cagatccagccgtccatctctctggccctgaggggagccaagaccttgtctggcaatatt
gactgccatgtcttccccttcttccacttcggcaagagcttcatcaaaggctgtcatgtc
tcttcagacagtttcatccagctggtcctgcagctggcccacttccgggacaggggtcaa
ttctgcctgacttatgaatcagccatgacccgactgtttctggaaggcaggacggagacg
gtgaggtcttgcactagagaggcctgccaatttgtgagagccatggaaaacaaggagagg
acagaccaacagtgccttgccctgttccgggaagccgtggacaagcaccaggccctgctg
aaggcagcaatgagtgggcaagggatcgaccgtcacctcttcgcactgtacatcatgtcc
cggcttctccacatgcagtcgcccttcctgacccaggtccagtcgcagcaatggcttctg
tctaccagccagatccctgtgcagcagacacacctgttcgatgtccacaattacccggat
tatgtttcctctggaggtggatttgggcctgcccatgaccatgggtatggcgtctcgtat
atcttcatgggggaaaacgcaatcagcttccacatctccagcaagcaatcaagcacagaa
acagactcacaccggctggggcagcacattgaagatgccctgttggatgtagcctccctg
ttccaggctggacagcaattcaagcgccagttcacagggctcggggagagttcaggttgg
aaatacagcaatctctcctgtaagactgtggaccccaatatccccaaatcctccaccaac
ttgtga

DBGET integrated database retrieval system