KEGG   Rattus norvegicus (rat): 25757Help
Entry
25757             CDS       T01003                                 

Gene name
Cpt1a, CPT-Ia
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    25757 (Cpt1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25757 (Cpt1a)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25757 (Cpt1a)
   04920 Adipocytokine signaling pathway
    25757 (Cpt1a)
   03320 PPAR signaling pathway
    25757 (Cpt1a)
  09159 Environmental adaptation
   04714 Thermogenesis
    25757 (Cpt1a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25757 (Cpt1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25757 (Cpt1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     25757 (Cpt1a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    25757 (Cpt1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 25757
NCBI-ProteinID: NP_113747
RGD: 2396
Ensembl: ENSRNOG00000014254
UniProt: P32198
Position
1q42
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPS
SWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPV
VGHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLL
ANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctcaccaagctgtggccttccagttcactgtcacccccgatggcattgac
ctccgcctgagccacgaagccctcaaacagatctgcctgtcggggctgcactcctggaag
aagaagttcatccggttcaagaatggcatcatcactggtgtgttccccgcgaatccgtcc
agctggcttatcgtggtggtgggtgtgatttcatccatgcatgccaaagtggacccctcc
ctgggcatgatcgcaaagatcagtcggaccctagacaccactggccgaatgtcaagccag
acgaagaacattgtgagcggcgtcctctttggtacagggctctgggtggcagtcatcatg
accatgcgctactcgctgaaggtgctgctctcctaccacggctggatgtttgcagaacac
ggcaaaatgagccgcagcaccaagatctggatggctatggtcaaggtcctctcaggtcgg
aagcccatgttgtacagcttccagacgtctctgccacgcctgcctgtcccagctgtcaaa
gatactgtgagcaggtacctggaatctgtgaggccactgatgaaggaagaagacttccag
cgcatgacagcactggcccaggattttgctgtcaacctcggacccaaattgcagtggtat
ttgaagctaaaatcctggtgggccacaaattacgtgagtgactggtgggaagaatatatc
tacctgcggggccgagggccgctcatggtcaacagcaactactacgccatggagatgctg
tacatcaccccaacccatatccaggcagcgagagctggcaacaccatccacgccatactg
ctgtatcgtcgcacattagaccgtgaggaactcaaacccattcgtcttctgggatccacc
attccactctgctcggcccagtgggagcgactcttcaatacttcccggatccctggggaa
gagacagacaccatccaacatatcaaggacagcaggcacattgttgtgtaccacagaggg
cggtacttcaaggtctggctctaccacgatgggaggctgctgaggccccgagagctggag
cagcagatgcagcagatcctggatgatccctcagagccacagcctggggaggccaagctg
gccgccctcactgctgcagacagagtgccctgggcaaagtgtcggcagacctattttgca
cgagggaaaaataagcagtccctggatgcggtggaaaaggcagcgttcttcgtgacgttg
gacgaatcggagcagggatacagagaggaggatcctgaggcatccatcgacagctacgcc
aaatccctgctgcatggaagatgctttgacaggtggtttgacaagtccatcacctttgtt
gtcttcaaaaacagcaagataggcataaatgcagagcactcctgggcggacgcgcccgtc
gtgggccatttgtgggagtatgtcatggccaccgacgtcttccagctgggttactcagag
gatggacactgtaaaggagacaccaaccccaacatccctaagcccacaaggctacaatgg
gacattccaggagagtgccaggaggtcatagatgcatccctgagcagcgccagtcttttg
gcaaatgatgtggacctgcattccttcccatttgactctttcggcaaaggcttgatcaag
aagtgccggacgagtcccgatgccttcatccagctggcgctgcagctcgcacattacaag
gacatgggcaagttctgcctcacatatgaggcctccatgacccggctcttccgagaaggg
aggacagagactgtacgctcctgcactatggagtcctgcaactttgtgcaggccatgatg
gaccccaagtcaacggcagagcagaggctcaagctgttcaagatagcttgtgagaagcac
cagcacctgtaccgcctcgccatgacgggcgccggcatcgaccgccatctcttctgcctc
tatgtggtgtccaagtatcttgcagtcgactcacctttcctgaaggaggtattgtctgag
ccatggaggttgtctacgagccagactcctcagcagcaggtggagctctttgactttgag
aaaaaccctgactatgtgtcctgtggagggggctttgggccggttgccgatgacggctat
ggtgtctcctacattatagtgggagagaattttatccacttccatatttcttccaagttc
tctagccctgagacagactcacaccgctttgggaagcacttgagacaagccatgatggac
attatcaccttgtttggcctcaccatcaattctaaaaagtaa

DBGET integrated database retrieval system