KEGG   Rattus norvegicus (rat): 257634Help
Entry
257634            CDS       T01003                                 

Gene name
Lhx1
Definition
(RefSeq) LIM homeobox 1
  KO
K09372  LIM homeobox protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    257634 (Lhx1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain with LIM region
    257634 (Lhx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 257634
NCBI-ProteinID: NP_665887
RGD: 71074
Ensembl: ENSRNOG00000002812
UniProt: P63007
Position
10q26
AA seq 406 aa AA seqDB search
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLDHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggtgcactgtgcgggctgcaaaaggcccattctggaccgtttcctcttgaacgtgctg
gacagggcctggcacgtcaagtgcgtccagtgctgtgaatgtaaatgcaacctgaccgag
aagtgcttctcccgggaaggcaagctctactgtaaaaacgacttcttccgatgtttcggt
accaaatgcgcgggttgtgcgcagggcatctctccaagcgatctggttcggagagcgcga
agcaaagtgtttcacctcaactgcttcacctgcatgatgtgtaacaagcagctctccacg
ggcgaggagctctacatcatcgatgagaacaagttcgtttgtaaagaggattacctgagt
aacagcagtgtcgccaaagagaacagcctccactcggccaccacaggcagtgaccctagt
ttatctccggattcccaagatccatcgcaggatgatgccaaggactctgaaagtgccaac
gtatcggataaggaaggtggtagcaatgagaacgatgaccagaacctaggtgccaagcgc
aggggaccgcggaccacgatcaaagccaagcaactggagacgttgaaggcagcctttgca
gctacgcctaagcccacacgccatatccgcgagcaattggcccaggagactggcctcaac
atgcgtgttatccaggtctggttccagaatcgacgctccaaggagcggaggatgaagcag
ctaagcgcgctgggtgcgcggcgccacgcctttttccgcagtcctcgccggatgcggcct
ctggtggaccgcttggagccgggcgaactcatccctaacggccccttctccttttatgga
gattaccagagtgagtactacggtcctggaggcaactacgacttcttcccgcaaggacca
ccgtcctcgcaggcccagacaccagtggacctaccctttgtgccatcatctgggccttcg
gggacgccccttggaggtctggaccacccgctgcctggccaccatccttccagcgaggcg
cagcgattcactgacatcctggcacatcccccaggggactcgcctagtcctgagcccagc
ttgcccgggcctctccactccatgtctgcggaggtctttgggcccagtccacctttctca
tctctgtcggtcaatggtggagccagctacgggaatcacttgtctcaccctcctgaaatg
aatgaggcagccgtgtggtag

DBGET integrated database retrieval system