KEGG   Rattus norvegicus (rat): 257642Help
Entry
257642            CDS       T01003                                 

Gene name
ribin
Definition
(RefSeq) rRNA promoter binding protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 257642
NCBI-ProteinID: NP_671477
RGD: 727924
UniProt: Q99JC0
Position
6q14
AA seq 295 aa AA seqDB search
MGGWSEAPRGGDPRRHPPGSPGAAATPAAAEAIHGKGPARVQSRRRRRPPRVSGPPAPPG
ARWFLPLRNPRGVGPAAPEPAPRADPRPAPRREEGGGKRGGDDAGDDGAPRGRGEGGPGR
KGRGVSPDVGEGGGASSSRGARPAPLRAPARPTQPLEPILIPKLRIRLADFPYLHCSNMP
EAVHLGDLLRIWVRPGARFTPSPPDFQGPARAHRTPPEPRRFPRHGPLSRGEPIPGRPAL
HKEKRTLPGAPAGFSGIGRVTALDASRRPSPPLRIRRSEPDSLSIGRASVKSWTK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgggggggtggagcgaggccccgcggggaggggacccgcgccggcacccgccgggctcc
ccgggagcggccgcgacgcccgccgcagctgaggcgatccacgggaagggcccggctcgc
gtccagagtcgccgccgccgccggcccccccgagtgtccgggccccccgccccaccgggg
gcccgctggttcctcccgctccggaacccccgcggggttggacccgccgccccggagccc
gcgccgcgcgccgacccccgacccgccccccgacgggaagaaggaggggggaagagaggt
ggcgacgacgcgggggacgacggggccccgcggggaagaggggagggcgggcccgggcgg
aaaggacggggggtctccccggacgtgggagagggcggcggcgcctcgtccagccgcggc
gcgcgcccagccccgcttcgcgccccagcccgaccgacccagcccttagagccaatcctt
atcccgaagttacggatccggcttgccgacttcccttacctacattgttccaacatgcca
gaggctgttcaccttggagacctgctgcggatatgggtacggcccggcgcgagatttaca
ccctctcccccggattttcaagggccagcgagagctcaccggacgccgccggaaccgcga
cgctttccaaggcacgggcccctctctcggggcgaacccattccagggcgccctgccctt
cacaaagaaaagagaactctccccggggctcccgccggcttctccgggatcggtcgcgtt
accgcactggacgcctcgcggcgcccatctccgccactccggattcggagatctgaaccc
gactccctttcgatcggccgagcctctgtcaagtcttggaccaagtaa

DBGET integrated database retrieval system