KEGG   Rattus norvegicus (rat): 257646Help
Entry
257646            CDS       T01003                                 

Gene name
Frmd6
Definition
(RefSeq) FERM domain containing 6
  KO
K16822  FERM domain-containing protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    257646 (Frmd6)
   04392 Hippo signaling pathway - multiple species
    257646 (Frmd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FERM_M FERM_C FERM_N
Motif
Other DBs
NCBI-GeneID: 257646
NCBI-ProteinID: NP_001257983
RGD: 727810
Ensembl: ENSRNOG00000007329
UniProt: F1LR29
Position
6q24
AA seq 614 aa AA seqDB search
MNKLTFHNNKVMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGKLISDRIA
RYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRKVHHGDYFEPEAYFPAWVV
SKRGKDYILKHIPNMHRDQFALTASEAYLKYIKEAVRLDDVAIHYYRLYKDKREVEGSLT
LGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLVYYTGCPT
RSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENEEKKQYRESYISDNLDLDMDPLEKRSRA
SGSSAGSMKHKRLSRHSTASHSSSHTSGIETDTKPRDPGPEDGYSGSVMHRKLKTCSSMT
SHGSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRDLEPMTEESLEVSPEMCIYITQDML
LSRKLNGHSGLIVKEISSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDI
RLYQKDFLRIAGLCQDTAQSYTFGCGHELDESGLYCDSCLAQQCVNMHDAFPVKRTSKYF
SLDLTHDEVPEFLV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactgaccttccataacaacaaagtcatgcaggaccgccgcagagtgtgtatt
ttcctccccaatgacaagtctgtgagcatcatcataaatgttaaaattctgtgtcaccag
ttgctggtccaggtgtgtgacctgctcaggttgaaggatagtcacctctttggtctcagt
gttatacaaaataatgaacacgtatatatggaattgtcacaaaagctctataagtattgt
ccaaaagaatggaaaaaggaggccagcaagggcatcgaccagtttgggcctcccatgatc
atccatttccgggtgcagtactatgtggagaacgggaagctgatcagtgaccggattgcg
agatactattattactggcacctaaggaaacaggtgctgcactctcagtgtgtgctcaga
gaggaggcctacttcctgctggcagcctttgcactgcaggctgacctcgggaacttcaaa
aggaaagtgcaccatggagactactttgagccagaggcttacttcccagcatgggtggtt
tccaagcgggggaaggactacatcctgaaacacattccaaacatgcacagagaccagttt
gcactgacagcctccgaggcatatctaaagtacatcaaagaggccgtccgactggatgac
gtcgccatccattactacagactgtacaaggataaaagagaggttgaaggttcactgacc
ctgggactgaccatgcgagggatacagatctttcagaatctagaagaagagaaacagttg
ctgtatgatttcccctggacaaatgttgggaagttggtgtttgtgggcaagaagtttgag
attttgcccgatggcctcccctccgccaggaagctggtctactacaccgggtgtcccaca
cgctcccggcatctcctgcagctgctgagcaacagccaccggctctacatgaacctgcag
cccgtcctgcgccacctccgcaagcaggaggagaatgaagagaaaaagcagtaccgggaa
tcctacatcagtgacaacctggaccttgacatggacccgctggaaaagcgatcccgtgcc
agcgggagcagcgctggcagcatgaagcacaagcgtttgtcccgccactccacggccagc
cacagcagctcccacacgtcaggcatcgagacagacactaagccccgggacccagggcca
gaagatggctattcaggcagcgtcatgcatcgaaagctgaagacctgtagctccatgacc
agccacggcagctcccacacctcaggcgttgaaagtggaggcaaagaccgcctggaggag
gactcgcaagatgatgaaatagagatgctggttgatgacccccgggacctggagcccatg
accgaagagtccctggaagtgagcccagagatgtgtatctacatcacacaagacatgctg
ctgtccaggaagctgaacgggcactcagggttaattgtgaaagaaatcagttcttccacc
tccagctcctcggagacggttgtcaagctgcgtggacagagcactgactctcttccacag
acgatatgtcgaaaaccaaagacttccactgatcggcatagcctgagccttgacgacatc
agactgtaccagaaagacttcctgcgcatcgcaggcctgtgtcaggacactgctcagagc
tacacgttcgggtgtggccatgaactggatgagagcggtctctactgcgacagctgcttg
gctcagcagtgtgtcaacatgcatgacgctttccccgtgaagagaaccagcaagtacttt
tctctggacctcactcacgacgaggtcccagagttccttgtctaa

DBGET integrated database retrieval system