KEGG   Rattus norvegicus (rat): 259170
Entry
259170            CDS       T01003                                 

Gene name
Casc3
Definition
(RefSeq) protein CASC3
  KO
K14323  protein CASC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    259170 (Casc3)
   03015 mRNA surveillance pathway
    259170 (Casc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    259170 (Casc3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     259170 (Casc3)
SSDB
Motif
Pfam: Btz
Other DBs
NCBI-GeneID: 259170
NCBI-ProteinID: NP_671485
RGD: 628766
Ensembl: ENSRNOG00000009716
UniProt: Q8K3X0
Position
10
AA seq 699 aa
MADRRRQRASQDTEDEESGASGSDSGSPARGGGSCSGSAGGGGSGSLPSQRGGRGGGLHL
RRVESGGAKSAEESECESEDGMEGDAVLSDYESAEDSEGEEEYSEEENSKVELKSEANDA
ADSSAKEKGEEKPESKGTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIP
RKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYD
IRSAHNPDDIKPRRIRKPRFGSPPQRDPNWIGDRSSKSHRHQGPGGNLPPRTFINRNAAG
TGRMSTSRNYSRSGGFKEGRTSFRPVEVGGQHGARSGETLKHEANYRSRRLEQTPMRDPS
PEPDAPLLGSPEKEEVASETPAAVPDITPPAPDRPIEKKSYSRARRTRTKVGDAVKAAEE
VPPPSEGLTSAATVPESTPPAAKTGNWEAPVDSTTGGLEQDVAQLNIAEQNWSPGQPSFL
QPRELRGMPNHIHMGAGPPPQFNRMEEMGVQSGRAKRYSSQRQRPVPEPPAPPVHISIME
GHYYDPLQFQGPIYTHGDSPAPLPPQGMIVQPEMHLPHPGLHPHQSPAPLPNPGLYPPPV
SMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGV
TYYNPAQQQVQPKPSPPRRTPQPVSIKPPPSEVVSRGSS
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggaccggcggcggcagcgcgcttcccaggacactgaggacgaagaatctggtgct
tcgggttccgacagcggctctcccgcacggggcggcggcagctgcagcgggagcgccgga
ggcggcggcagtggctcgctgccttctcagcgcggcggccgcggcgggggccttcatctg
cgacgggtggagagcgggggcgccaagagcgcagaggagtctgagtgtgagagtgaagat
ggcatggaaggagatgctgttctctccgattatgaaagtgcagaagattcagaaggtgaa
gaagaatacagtgaagaggagaattccaaggtagagctgaaatcagaagctaatgatgct
gctgattcctctgcaaaagagaagggagaagaaaagccggaatctaaaggcaccgtgacg
ggggagaggcaaagtggggatggacaggagagcacagagcctgtggagaacaaagtgggt
aaaaaaggccctaagcatttggatgatgatgaagatcggaaaaacccagcgtatattccc
aggaaagggctcttctttgagcatgatcttcgaggacagactcaggaagaggaagtccga
cccaagggacggcagcgaaaactatggaaagatgagggtcgctgggagcatgataagttc
cgtgaggatgaacaggctccaaaatctcgacaggagctaattgcactttatggctatgac
attcggtctgctcataatcctgatgacatcaaaccccgaagaatccggaaacctcgattt
ggaagtcccccacaaagagatccaaactggattggtgaccgatcaagcaaatcccatcgc
caccagggtcctgggggcaacctaccacctaggacatttattaacaggaatgcagcaggt
actggccgcatgtctacatccaggaattattctcgatctgggggcttcaaggaaggtcgt
actagttttaggcctgtggaggttggtgggcagcatggtgcccggtctggtgagactctt
aagcatgaagctaattaccggtcacggcgtctggagcagactcctatgagggatccatct
ccagaaccagatgctccattgcttggaagtcctgagaaagaagaggtggcctcagagaca
ccagctgctgtacctgacatcacaccgccagctcctgacagacctattgagaagaaatcc
tattcccgggcaagaaggacccggaccaaagttggggatgcagtcaaagcagctgaagag
gttcctcctccatctgaagggctcacttcagcagccacggtcccagaatctactcctcca
gctgctaagactgggaactgggaggctccagtggattctaccacaggtggacttgagcaa
gatgtggcacagctaaatatagcagaacaaaattggagtccaggacagccttcattcctg
cagccacgggaacttcgaggtatgcctaaccacatccatatgggagcaggacctccacct
cagtttaaccggatggaagaaatgggtgtgcagagtggtcgagctaagcgttactcttcc
cagcggcagcggcctgtgccagagccccctgctcctcctgtgcatatcagtatcatggag
ggacattactatgatccattgcagttccagggaccaatctatacccatggtgacagccct
gccccactgcccccacagggcatgattgtacagccagaaatgcaccttcctcacccaggt
ttacacccccaccagtcaccagcacctctgcccaatccgggtctctacccaccaccagtg
tccatgtccccaggacagccaccgccccagcagttgcttgctcccacctacttttctgct
ccgggtgtcatgaattttggtaaccctagttacccttatgctccgggagcactgcctcct
cctccacctcctcatctgtatcctaatacacaggctccatcacaggtgtatggaggagtg
acttactataaccctgcccagcagcaggtacagccaaagccctctccaccccggaggact
ccccagccagtctccatcaagccccctccatctgaggttgtaagcagaggttccagttaa

DBGET integrated database retrieval system