KEGG   Rattus norvegicus (rat): 259171Help
Entry
259171            CDS       T01003                                 

Gene name
Dclre1c, Snm1l
Definition
(RefSeq) DNA cross-link repair 1C
  KO
K10887  DNA cross-link repair 1C protein [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    259171 (Dclre1c)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    259171 (Dclre1c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     259171 (Dclre1c)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     259171 (Dclre1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 259171
NCBI-ProteinID: NP_671486
RGD: 708574
Ensembl: ENSRNOG00000015980
UniProt: Q5XIX3
Position
17q12.3
AA seq 698 aa AA seqDB search
MSSFQGQMEEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSMKRRLECSLKVFLY
CSPVTKELLLTSPKYKFWENRIIAIEIETPTQVSLVDEASGEKEEVVVTLLPAGHCPGSV
MFLFQGSNGTVLYTGDFRLAKGEVSRMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE
ECLRGVLELVRSWITRSPKHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMPD
ILHHLTTDRNTQIHACRHPKAEEYFQWNKLPCGMASKTKTVLHTISIKPSTMWFGERTRK
TNVIVRTGESSYRACFSFHSSYSEIKDFLSYICPVNAYPNVIPIGLTVDKVMDFLKPLCR
SSQCAEPKYKPLGKLKRARTVHLDSEEDDDLFDDPLLTHSRRKVPYQVTLHPEVFSMKAL
PLDQPELGQSPGCCKAESMPSPSLANFVDCDESNSDSEGELETPPSLQGGLGPTTLPQQN
ADPDVDVPRWEVFFKRKDEITDECLENLPSSIETGGSQSPKRFSDSPKLGSDSDGESTHI
SSQNSSQSTHITDQGSQGWDSQCDTVLLSSQEKSGGDSTSLNKDTYKPKPKDSISASQIE
QNALCPQDTHCDLKSGAEVNGVPCIEEPDTVSGRKSSPEKTSLTSTQADSQSSSDFEIPS
TPEAELPKPEHLQFLYGKLATGESIVLKKENVHSQIFK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttccagggacagatggaggaatatccaaccatctccattgaccgcttcgac
agagagaacctgaaagcccgtgcctacttcctttcgcactgccacaaggatcacatgaaa
ggattaagggctccttccatgaaaagaaggctggaatgcagtttgaaggtcttcctgtac
tgttctccagtcactaaggagctgctcttaaccagcccaaagtacaagttctgggaaaac
cgaattatagcaattgaaattgaaactcctacccaggtatctttagttgatgaggcatcg
ggtgagaaggaagaagttgttgtgactctcttaccagctggtcactgcccaggttcagtt
atgtttctatttcagggcagtaatggaactgtcttatacacaggagacttcagactggcg
aaaggagaagtttccagaatggagcttctgcactctgggggcagagtaaaagacatccaa
agtgtatatttagacaccactttctgtgacccaaggttttatcaaattccaagtcgtgag
gagtgcttgaggggcgttctggagctggttcggagctggatcacgaggagtccgaagcac
gtcgtgtggctgaactgcaaggccgcctacggctatgagtacttattcaccaacctgagt
gaggagctgggagtccaggttcatgtggacaagctggacatgtttaaaaacatgcctgat
atcctgcaccatctcacaacggatcgaaacacccagatccacgcctgccgccacccgaag
gcagaagagtattttcagtggaataagttaccctgtggcatggcttccaaaactaaaact
gtactccacacaatcagcatcaagccatctaccatgtggtttggagagaggaccagaaaa
acaaacgtgattgtgagaaccggagagagctcatacagagcttgcttctctttccactcc
tcctacagtgagattaaagattttttgagctacatctgcccagtgaatgcgtatccaaat
gtcattccgatcggcctcactgtggataaggtcatggactttttaaagcctctgtgccgc
tcttcccaatgtgctgaaccaaagtacaagcccctcgggaaactgaagagagctagaaca
gttcaccttgactcagaggaagatgatgatctctttgatgaccctctactaacacattca
aggcgcaaagttccgtaccaagtaactcttcaccctgaggtattttcaatgaaggcacta
ccgctagatcagcctgaactgggacaaagccccggatgctgtaaagcagagagtatgccg
agtccttctttggccaactttgtggactgtgacgagtccaacagtgacagtgaaggagag
ttagagaccccgccttctctgcagggaggtctcggccccacaacactcccacagcaaaac
gctgatccggatgtggatgtacctcggtgggaagtattcttcaaaagaaaagatgaaatc
acagatgaatgtttggaaaacttaccttcctccatagagacagggggatcgcagtcacca
aagcgtttcagtgactcaccaaagctgggcagtgactctgatggagaatccacccatatc
tcttcccagaattcatctcagtcaacccacataacggatcaaggaagccaaggctgggac
agccagtgtgataccgttttgttatcttcccaagagaaaagtggtggggatagcacctct
ttgaacaaggatacctacaaaccaaaacccaaagatagtatttctgcctcccaaatagaa
cagaatgcactttgtccacaggatactcactgtgatttgaaaagcggagctgaagtaaat
ggagtcccttgtattgaagaaccagacactgtgagtggcaggaaatcttcacctgagaaa
acatcgctaaccagcacacaggcagactcacagagctcctctgactttgaaatcccctca
actccagaagctgagcttcccaagccagagcatttacagttcttatatggaaagctggca
acaggtgagagtatagtgttgaaaaaagaaaatgttcactcccagatatttaaataa

DBGET integrated database retrieval system