KEGG   Rattus norvegicus (rat): 259233Help
Entry
259233            CDS       T01003                                 

Gene name
Gpx6, OBPII, Ry2d1
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    259233 (Gpx6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    259233 (Gpx6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    259233 (Gpx6)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     259233 (Gpx6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 259233
NCBI-ProteinID: NP_671694
RGD: 628789
Ensembl: ENSRNOG00000060749
UniProt: Q64625
Position
17q11
AA seq 221 aa AA seqDB search
MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYA
GKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLK
YVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIR
WNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcagttctggggtccctgtcttttctcattgtttatggctgtattggctcag
gagacactggatcctcaaaaatcaaaggtggattgcaacaaaggggtggctggcaccgtc
tatgagtacggagccaacaccttagatggtggggagtatgtccagttccagcagtatgca
ggaaagcacattctctttgtcaacgtggcgtccttctgtggcctgacagctacgtaccct
gaactgaacacattgcaggaggagctgagaccattcaatgtcagtgttttgggctttcca
tgcaaccagtttggaaaacaagaacctggaaagaactcagagatcctccttggactcaaa
tatgttcgcccaggcggtggctttgttcccaatttccagctctttgagaagggggatgtg
aacggagacaatgaacaaaaggttttttctttcctaaagagctcctgccctcccacctct
gaacttcttggctctccagaacatctcttctgggatcccatgaaggtccatgacattcgc
tggaactttgagaagttcctggtgggaccggatggagcccctgtcatgcgctggttccac
cagactcctgtcagagttgtccagtcagacatcatggagtacctaaaccaaacccgtacc
cagtag

DBGET integrated database retrieval system