KEGG   Rattus norvegicus (rat): 259242Help
Entry
259242            CDS       T01003                                 

Gene name
Wipf3, Cr16
Definition
(RefSeq) WAS/WASL interacting protein family, member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    259242 (Wipf3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    259242 (Wipf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    259242 (Wipf3)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    259242 (Wipf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2
Motif
Other DBs
NCBI-GeneID: 259242
NCBI-ProteinID: NP_671744
RGD: 708559
Ensembl: ENSRNOG00000009571
UniProt: Q9Z0G8
Position
4q24
AA seq 451 aa AA seqDB search
MPVPPPPPPPLPPPPPPLGAPPPPPPPGPPISTDAPSLRKSDLKGRSALLADIQQGTRLR
KVTQINDRSAPQIESSKGTSKEGGAAGSNARGGSTPPALGDLFAGGFPVLRPAGQRDVAG
GKTGQGPGSRAPSPRLPTKAISGPLPAPASPRLGNASDTHSSARPVPPRPSVPAPPPPTT
PPPPPPPPPPPPPPPLPPASPIKAPSVSPPVPPTKGNPSAVPAPIPCVPPLPPPPPTPPP
LPPASALSEKAVRPQLAPLHLPPIPPPLPLLPPYGYPALHSEPSSPAQDVREPPAPPPPP
PPPPPPPPPPLPTYASCSPRAAVAPPPPPLPGSSNSGSETPPPLPPKSPSFQTQKALPTP
PGAPGPQIILQKKRRGPGAGGGKLNPPPAPPARSPTTELSSKTQQPGGQLRNGGQHVIGR
TPGSWLQAEAAGQSSDDIKTRNSQLSLKALR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgccaccaccaccacccccacctcttcctccaccccctccacctctgggagct
cctccccctccacccccaccagggcccccgatcagcacagacgctcccagcttaaggaag
tcagatctgaaaggtcggagtgcactgttggctgatatccagcaaggaacacgcctgcga
aaagtcacccagatcaatgaccgcagtgccccacaaatcgagagttcaaaaggaaccagc
aaagagggaggagctgctggcagcaatgcccgtggaggaagcacgccccctgccctggga
gatctctttgctggtggctttcctgtgttgaggccagcaggccagcgggatgtggcaggt
ggcaagaccggacagggccctggctcccgagcgccttctccccggctccccaccaaagcc
atcagcggcccccttcccgctcctgcatcccccaggctaggcaatgcctcagatacacac
agctctgccaggccagtccctcctcgccccagtgtacctgccccaccgcctcccactaca
cccccacccccgcctccacctccacctccacctccacctccacccctccccccagcctcc
cccatcaaagccccatcggtgtccccacctgtccctccaaccaaggggaatccgtctgcg
gtgccagcccctataccctgcgtacctccccttccgccccctcccccgactccgccccct
ctgcccccagcctcagcactcagtgagaaggcagtgaggccccaactagccccgctgcac
ctgccacccataccacctccgcttcctctcctgccaccctatgggtacccggcgctccac
tcagagcccagcagccctgcccaggacgtgagagagccaccagctcctcctccaccaccg
ccaccaccaccaccacctccaccaccaccgctccccacctacgcctcttgctctccaagg
gccgctgtggccccgcccccgccccctttgccaggctccagcaacagcggcagcgagact
cctcccccgctgccccccaagtcccccagcttccagacgcagaaagccttgcccacacct
ccaggtgctcccggccctcagatcatcctgcagaagaagcgtcgaggcccaggagccggt
gggggaaagctaaacccacctccagccccacctgcaagatcgcccaccactgagctctcc
agcaaaacccagcagcctggaggacagctgcggaatggaggccagcacgtgattggccgc
acacctggttcctggctccaagctgaggcagctgggcagagctctgatgacatcaaaacc
agaaattctcagttatctctaaaggcactccggtga

DBGET integrated database retrieval system