KEGG   Rattus norvegicus (rat): 259243Help
Entry
259243            CDS       T01003                                 

Gene name
Kcnip4, Kchip4
Definition
(RefSeq) potassium voltage-gated channel interacting protein 4
  KO
K23855   
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EF-hand_4 DUF5314 Dockerin_1
Motif
Other DBs
NCBI-GeneID: 259243
NCBI-ProteinID: NP_852030
RGD: 708539
Ensembl: ENSRNOG00000032350
UniProt: Q99MG9
Position
14q11
AA seq 250 aa AA seqDB search
MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgagaagggtggaaagcatctcggctcagctggaggaggcgagctccacaggc
ggtttcctctacgctcagaacaacaccaagcgcagcattaaagagcggctcatgaagctc
ttgccctgctcagctgccaaaacgtcgtctcctgctattcaaaacagtgtggaagatgaa
ctggagatggccactgtcaggcaccggcctgaagccctggagctgctggaggcccagagc
aaattcaccaagaaagagcttcagatcctttacagaggatttaagaatgaatgccccagt
ggtgttgttaatgaagaaaccttcaaggagatttactcgcagttcttcccacagggagac
tccaccacatatgcacattttctcttcaatgcattcgacacggaccacaatggagctgtg
agctttgaggatttcatcaaaggtctttccattttgcttcgagggacagtacaagaaaaa
ctgaactgggcatttaatttgtatgacataaacaaagatggctacatcactaaagaggaa
atgctggacataatgaaagcaatttacgacatgatggggaaatgcacataccctgtcctc
aaggaagatgctccccgacagcacgtggagacatttttccagaagatggacaagaataaa
gatggtgtcgttaccatagacgagttcattgaaagttgccaaaaagatgaaaacataatg
cgctccatgcagctctttgaaaatgtgatctag

DBGET integrated database retrieval system