KEGG   Rattus norvegicus (rat): 259269Help
Entry
259269            CDS       T01003                                 

Gene name
Erc2, CAST, Cmbp
Definition
(RefSeq) ELKS/RAB6-interacting/CAST family member 2
  KO
K19878  ELKS/RAB6-interacting/CAST family member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    259269 (Erc2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Others
   Others
    259269 (Erc2)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    259269 (Erc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cast PKcGMP_CC HMMR_N ATG16 HIP1_clath_bdg
Motif
Other DBs
NCBI-GeneID: 259269
NCBI-ProteinID: NP_740768
RGD: 708372
Ensembl: ENSRNOG00000015148
UniProt: Q8K3M6
Position
16p16
AA seq 921 aa AA seqDB search
MYGSARTISNPEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSG
PMYLSDHEGVASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQ
HGGLGGSSHHHHHQVPSMLRQVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMN
SIKTFWSPELKKERVLRKEEAARMSVLKEQMRVSHEENQLLDARRTKHLQLTIQALQDEL
RTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIE
TQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKEKE
NIHLREELHRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNT
EDREEEIKQIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIE
VLKESLTAKEQRAAILQTEIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEE
ALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKE
HASSLASAGLKRDSKLKSLEIAIEQKKEECNKLEAQLKKQAEQLFNQMYNPAHNIEDDSR
MNPEFADRLKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLR
HMKDQNKKVANLKHNQQLEKKKNAQLLEEVRRREDSMVDNSQHLQIEELMNALEKTRQEL
DATKARLASTQQSLAEKEAHLANLRMERRKQLEEILEMKQEALLAAISEKDANIALLELS
ASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDDDHHHYHHHHHHHHHRSPG
RSQHSNHRPSPDQDDEEGIWA
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggagcgcaagaacaatcagcaatccggaaggcagcccttccagatcgccgcgt
ttgccaaggtctcctcgtttgggccaccgaagaacaagcagtgggggagggggagggaca
ggcaagactctgtctatggagaacatccagtcccttaatgcggcctatgccacgtctgga
cccatgtacttgagtgaccatgaaggggtggcatcaacaacttacccaaagggcaccatg
actctaggcagggccacaaatcgagctgtttatggaggccgggtcacagccatggggagt
agtcccaatattgcttccgctggactttcccacacagatgtcctttcatatacggatcaa
catggagggctgggtggctcatcccaccaccaccaccaccaggtgccctccatgttgagg
caggtaagagacagcacgatgttggatcttcaagcccagctcaaagaactgcagagagag
aatgacctccttcgcaaggagcttgacattaaggacagcaaactggggtcttccatgaat
agcatcaagactttctggagtcccgagcttaagaaggagagagtcttgaggaaagaggag
gctgctcgcatgtctgtcctcaaggagcagatgagggtttctcacgaagaaaaccagtta
ctggacgccagaagaacgaagcacctgcagttgaccatccaggcccttcaggatgaactg
cggacccagagagacctcaaccacctcctgcagcaagagagtggcaaccgaggagcagag
catttcaccatcgagctgacggaggagaacttccgcaggctccaagccgaacacgacagg
caggccaaggagctgttccttctgcggaagacattggaagaaatggagctaaggattgaa
acacagaaacagactctcaatgcccgcgacgagtccattaaaaagctcctggagatgctg
cagagtaagggcttgccatcgaaaagcctagaggacgacaacgagcgcacacggcggatg
gccgaggctgagtctcaggtcagccacttggaagtgattttagaccagaaggagaaggaa
aacatccacctgagagaggaattgcaccgaagaagccaacttcagccggagccagccaag
acgaaggcgctccagactgtcatcgaaatgaaggacacaaaaattgcttcactggagcgg
aacatccgggacctcgaggatgagatccagatgttgaaagccaatggtgtgctcaacaca
gaggaccgagaggaggagatcaaacagatcgaggtgtacaaaagccactccaagtttatg
aagaccaagattgaccagctgaaacaggaactttccaagaaggagtcagaacttcttgcc
ttacaaacaaagcttgaaacccttagcaatcagaattcagattgcaagcaacacattgaa
gtgcttaaagagtcacttactgccaaagaacagagggctgccatccttcagactgagatt
gaaaacttgcaagaacaacttagggataaggacaaacaactgaccaacctgaaagacaga
gtgaagtccctgcagacggactccagcaacactgacactgctctggccactctggaggag
gccttgtcggaaaaggagagaataatagagcgcttgaaagagcagagggagagagatgat
cgggaaagactagaagagatagaatcctttcgaaaggagaacaaagacctcaaagagaag
gtcaatgctttacaggctgagctgacagagaaagagtctagtttaatcgacctcaaagaa
catgcatcttcattagcttctgcaggactgaagagggactcgaaactgaagtctctagaa
atagccattgaacaaaagaaggaggaatgcaacaaactagaagcacaattgaaaaagcaa
gctgaacagttgttcaatcagatgtacaatccagcacataatattgaagatgactccagg
atgaaccccgagtttgcagaccgactgaaacagctggacaaggaagcatcttactaccgt
gatgagtgtggcaaggctcaagcagaagtcgacaggttgctggagatcctcaaggaggtg
gagaatgagaaaaacgacaaagacaagaagattgcggaacttgagagcttgactctcagg
catatgaaagatcagaataagaaggtggccaacctcaagcacaaccaacagctggagaag
aagaagaacgcccagttattagaagaagtgcgccggcgagaagatagcatggttgacaac
tcacagcatttgcagatcgaggagctgatgaatgccttggagaagaccagacaggaactg
gacgccaccaaagcacgcctcgcctctacccagcaatcattggctgagaaggaagcacac
ctagccaatctccggatggagaggaggaaacaactagaggagatcttggagatgaaacag
gaagcgttacttgcggccatcagtgaaaaggatgcaaacattgccttgctggagttatct
gcctccaagaagaaaaagacgcaggaggaagtcatggcactgaagcgagagaaagaccga
ctggtgcatcagttaaagcagcagacccagaatagaatgaagctgatggcagacaactat
gacgacgaccaccaccattaccaccaccaccaccatcaccaccaccaccggtctcctggg
aggtcacagcattccaaccacaggccctctccggaccaggatgacgaggagggcatatgg
gcatag

DBGET integrated database retrieval system