KEGG   Rattus norvegicus (rat): 260321Help
Entry
260321            CDS       T01003                                 

Gene name
Fkbp4, FKBP-4, FKBP-52, p59
Definition
(RefSeq) FK506 binding protein 4
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    260321 (Fkbp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    260321 (Fkbp4)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     260321 (Fkbp4)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    260321 (Fkbp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 TPR_6 TPR_16 TPR_14 TPR_19 TPR_7 FKBP_N_2 TPR_9 TPR_17 PknG_TPR OmpH
Motif
Other DBs
NCBI-GeneID: 260321
NCBI-ProteinID: NP_001178792
RGD: 628729
Ensembl: ENSRNOG00000006444
UniProt: Q9QVC8
Position
4q42
AA seq 458 aa AA seqDB search
MTAEEMKVAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETAMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEDEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYYND
RLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPH
AELRYEVHLKSFEKAKASWEMNSEEKLEQSNIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE
EEHKAKTEVAAGDHPTDAEMKGEPNNVAGNQAQVKTEA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgaggagatgaaggtggcggagaacggggcgcaatcggcgcccctgcctctc
gaaggagtggacatcagccccaagcaggacgagggcgtgctcaaggtcatcaagagagag
ggtacaggcacagagacagccatgattggggaccgagtctttgtccactacactggctgg
ctgctagatggcacaaagtttgactccagtttggaccgcaaggacaaattctcctttgac
ctgggaaaaggggaggtcatcaaggcttgggatattgctgtggcaaccatgaaagtgggg
gaagtgtgccacatcacctgcaagccagaatacgcctacggttcagcaggcagccctcca
aagattcccccaaatgccacacttgtatttgaggtggagctgtttgagttcaaaggagaa
gatcttacagaagatgaagatggtgggatcatccgcagaatacggactcggggggaaggc
tatgccaggcccaatgatggcgctatggtagaagtggcactagaaggctactataatgac
cggctgtttgaccagcgggagctctgctttgaagtcggggaaggggaaagcctggatctg
ccctgtgggctggaggaggccattcagcgcatggagaaaggagaacattccattgtgtac
ctcaaacctagctatgcttttggcagtgttgggaaggaaaggttccagatcccaccacat
gctgagctgaggtatgaagtacatctgaagagttttgagaaggccaaggcatcttgggag
atgaactctgaggagaagctggagcagagcaacatagtgaaagaaaggggcaccgtgtac
ttcaaggaaggcaagtacaagcaagccttactgcagtacaagaagattgtgtcttggcta
gaatacgagtctagtttttccggtgaggaaatgcaaaaggtccatgcgctccgactggcc
tcacatctcaatctggccatgtgtcacctgaaactgcaggccttctcagctgccatcgaa
agctgtaacaaggccttggagctggacagcaacaatgagaagggcctgtttcgccgggga
gaggcacacctggccgtgaatgactttgacctggcacgagctgacttccaaaaggtcctg
cagctctatcccagcaacaaagccgccaagacccagctggctgtgtgccagcagcggacc
cgcaggcagcttgcccgggaaaagaagctctatgccaacatgtttgagaggctggctgag
gaggaacataaggccaagacagaagtggctgcaggagaccatcccactgatgctgagatg
aagggtgagccgaacaatgtggcaggcaaccaggctcaggtgaagacagaagcatag

DBGET integrated database retrieval system