KEGG   Rattus norvegicus (rat): 260323Help
Entry
260323            CDS       T01003                                 

Gene name
Snx27, Mrt1
Definition
(RefSeq) sorting nexin family member 27
  KO
K17936  sorting nexin-27
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    260323 (Snx27)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    260323 (Snx27)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   Others
    260323 (Snx27)
Transporters [BR:rno02000]
 Other Transporters
  Others
   260323 (Snx27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PDZ_6 PDZ RA PDZ_2 SNX17_FERM_C USP7_C2 UBX RBD YscW FERM_N
Motif
Other DBs
NCBI-GeneID: 260323
NCBI-ProteinID: NP_001103621
RGD: 628705
Ensembl: ENSRNOG00000020893
UniProt: Q8K4V4 M0RBS9
Structure
PDB: 

Position
2q34
AA seq 539 aa AA seqDB search
MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVS
EGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIR
AGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKFVV
YNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEY
LEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGATVTVRVKKNSTTDQVYQ
AIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRKWLF
TTEEEVLLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCE
GYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEE
GMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggacggggaagggattcacccctcagccccgcaccggaatggaggcggc
ggcggggggtctgggctccactgcgccgggaacggtggcgggggaggcggcggcccgcgg
gtcgtgcgcattgtcaagtccgaatccggctacggcttcaacgtgcggggccaagtgagc
gagggcgggcaactgcggagcatcaacggggagctgtacgcgccgctgcagcatgtgagc
gccgtgctgcccgggggggcggccgaccgggccggggtgcgcaagggggaccgcatcctg
gaggtgaacggcgtgaatgttgagggggcgacacacaagcaggtggtggacctgatccga
gcaggcgagaaggaattgatcttgacagtgttgtctgtacctcctcatgaggctgataac
ctagaccccagtgacgactccttgggacaatcattttatgattacacagaaaagcaagca
gtgcccatatcggtccccacatacaaacatgtggagcagaatggtgagaaatttgtggta
tacaatgtttatatggccgggaggcagctgtgttctaagcggtaccgggagtttgccatt
ctgcaccaaaacctgaagagagagtttgccaactttacatttcctcgacttccaggaaag
tggccattctcattatcagagcaacagttagatgcccggcgtcgggggttggaagaatat
ctagaaaaggtgtgctccatccgagtcattggtgagagcgacatcatgcaggagttcctg
tcagaatctgatgagaattacaatggtgtgtctgatgtggagctgagagtagcattacca
gatggagcaactgttactgtcagagttaaaaagaacagcaccacagaccaagtgtaccag
gctattgcagcaaaggttggcatggacagtacaacagtgaactactttgccttatttgaa
gtcatcaatcattcctttgtacgtaagctggcccctaatgaatttcctcataaactgtac
gtccagaattacacatcagctgtgccaggcacctgcctgaccattcgcaagtggctcttt
accacagaagaagaagtcctcttaaatgacaatgaccttgctgtcacgtacttctttcat
caggctgttgatgatgtaaagaaaggttacattaaagcggaggagaagtcttaccagtta
cagaagctgtatgaacaaaggaagatggtcatgtacctcaacatgctaaggacctgtgag
ggctacaatgaaatcatcttccctcactgtgcctgcgactccaggaggaaggggcatgtt
atcacagccatcagcatcacgcactttaaacttcatgcctgcactgaagaagggcagctg
gagaaccaggtaatagcgtttgaatgggatgagatgcagcgatgggacacagacgaagaa
ggaatggccttctgttttgaatatgcacgaggagagaagaagcctcgatgggttaaaatc
ttcacaccatatttcaattacatgcatgagtgctttgagagggtgttctgcgagctcaag
tggagaaaagagaatattttccagatggcgaggtcacaacagagggatgtggccacctag

DBGET integrated database retrieval system