KEGG   Rattus norvegicus (rat): 260430
Entry
260430            CDS       T01003                                 

Gene name
Gpr156
Definition
(RefSeq) probable G-protein coupled receptor 156
  KO
K04617  gamma-aminobutyric acid type B receptor-like
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    260430 (Gpr156)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    260430 (Gpr156)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  GABA
   260430 (Gpr156)
SSDB
Motif
Pfam: 7tm_3 TBCA DHR10 NYD-SP28
Other DBs
NCBI-GeneID: 260430
NCBI-ProteinID: NP_695207
RGD: 708438
Ensembl: ENSRNOG00000002797
UniProt: Q8K451
Position
11
AA seq 792 aa
MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITDSQHGSADISPLSPALLGVIWTFLSCG
LLLVLFFLAFTIRCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDALVGSSVEALI
QTRLSLLCIGTTLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILL
VTWVLTDPIQCLQILGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGA
YLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT
TTVNCCVFLPQLRQRKAFEGENQTIRHMAKYFSTPSKTFRSKFDEDQSCHLRDEXSCMER
LLTEKNAVIESLQEQVSNAKEKLVKLMSAECALDSPEWAVPAAASAGGPAECXATSEKES
GAAAEDSLPASAASQHMQGPGASRRDXSPSPDQKYDMPLKQFCDHLDMGCSQKPKAEQSE
GPERGNQEPMAPGQSLMTDGVACEPHRPRQNSEVLPERLPRVSSVVREKLQEVLQELDLG
TEAPLSPLPCPQQPWKSNTSGSPQKLSPSKLGFSPYVVRRRRAAQRARSRIPGSVGLKMG
HQANNTVSGSQNGLIVQNRDSPRLDHHNARSKEPRSSSVKPSPISAPHQRRGSLEGSKQC
ETEPQEARGYSVAFPRQPSASAPAQSSTAPCLSSXPALPRQRQPLPLLSPGCPSLSSGCY
NLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQTSGLASWEKLLARSKPV
VNFKDDLKPTLV
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggagccggaaatcaactgctctgaattctgtgacagttttcctggtcaagagctggat
cggagaccccttcatgatctttgcaagacaaccattaccgactcccagcatggtagtgcg
gacatctccccactgtctcctgccctcctgggtgttatttggacctttctcagctgtggg
ctacttctggtgcttttctttctggctttcacaatccgctgcaggaagaacaggattgtg
aagatgtccagccccaatctgaacattgtgaccttgctgggcagttgtctgacctacagc
agcgcttaccttttcgggattcaggacgctcttgtggggagttcagtggaagctctcatt
cagacgagactgtccttgctgtgcatcgggacgaccctggtgtttggccctattctgggg
aagagctggcgactctacaaagtgtttacccagagagtcccggacaagagagtgattatc
aaagacctgcagttgctggggttggtggcagccctggtggtggctgatgtaatcctgctc
gtgacgtgggtgctgacggatcccatccagtgcctccagatccttggtgtcagcatgaag
gtgacagggagagatgtatcctgctctttgaccaacacacatttctgtgcttcacggtac
tctgatgtctggattgccctggttttgggatgcaaggggctgctgctgctgtatggcgct
tacctggctggcctgaccaaccatgtcagctctcctccagtgaaccagtctttgaccatc
atggtcggagtcaacctcctgctcctcactgctggcctgctttttgtggtcaccagatac
ttgcactcctggcccaatctggtctttggactcacatcyggaggtatcttcgtttgcacc
accaccgtgaactgctgtgtcttccttccccagctgaggcagcggaaggcatttgaagga
gaaaaccaaacaatcagacacatggccaaatacttcagcactcccagcaaaaccttccgc
agcaagttcgacgaggaccagagctgccacttgagagatgagaasagctgcatggagagg
ctcctcacggaaaaaaacgcagtaatcgaaagcctgcaagagcaagtgagcaatgccaag
gagaagctggtgaagttgatgtctgcggagtgcgccctggactccccagagtgggccgtc
ccagctgcagcctctgccggtggaccygcagaatgccycgctacttctgagaaagagagc
ggagcagctgctgaggactccctacctgcctcagcggcctcccagcacatgcaaggcccc
ggggcatcgagaagggacrccagtccctctccagaccaaaagtacgacatgcctttgaaa
cagttttgtgatcatttggacatgggctgcagccaaaagccaaaggctgaacaaagcgag
ggtcctgaaagaggaaaccaggaacccatggcccccggtcagagtctaatgacagatgga
gtggcttgtgaaccccataggcccaggcagaactcagaggtactcccggagaggctaccc
cgggttagttcagtggtcagagagaagcttcaggaagttctacaagagctggacctgggc
accgaggctcccctttccccactgccttgtccccagcagccctggaagagtaacacttcc
ggcagcccccagaagctgtccccatctaaactgggtttcagcccgtatgtggtgagaagg
agacgggcagcccagcgggctcgctcacgcatccctggctctgtgggcctcaagatgggg
catcaagcaaataatactgtttctggttcacaaaatgggcttattgtacagaacagagac
agccccaggctggaccaccacaatgcaaggtccaaggaaccaaggtcctcttctgtaaaa
ccatctccaatctcagcacctcaccagagacggggtagcctggagggcagcaaacagtgt
gagacagagcctcaggaggccaggggatacagtgtagcttttcctcgacaaccttctgct
tctgccccggcacaaagttccactgccccatgcctatcctcttyaccagcgctgcccagg
cagcgtcagcctctacccctactgtcccctggctgtccttccttgtcttctgggtgctac
aaccttgacagtgagtctagcagctcagatgagttcttctgccgctgccacaggccctac
tgtgaaatttgcttccagagctctttggactccaatgacagtgacacttcagacagtgac
cttgagcagacttcaggattggcctcctgggaaaagctgttggcccgctccaagcctgtt
gtgaacttcaaagatgacttgaagcccacactagtgtga

DBGET integrated database retrieval system