KEGG   Rattus norvegicus (rat): 261730Help
Entry
261730            CDS       T01003                                 

Gene name
Aurka, ARK-1, Stk6
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    261730 (Aurka)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    261730 (Aurka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     261730 (Aurka)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   261730 (Aurka)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     261730 (Aurka)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    261730 (Aurka)
   Spindle formation proteins
    261730 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    261730 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH FTA2 Seadorna_VP7 LBP_C YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 261730
NCBI-ProteinID: NP_695208
RGD: 628895
Ensembl: ENSRNOG00000004479
UniProt: Q3MHU2
Position
3q42
AA seq 397 aa AA seqDB search
MDRCKENCVSRPVKSTVPFGPKRVLVTEQIPSQHPGSASSGQAQRVLCPSNSQRVPPQAQ
KPVAGQKPVLKQLPAASGPRPASRLSNPQKSEQPQPAASGNNSEKEQTSIQKTEDSKKRQ
WTLEDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSH
LRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYC
HSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHD
EKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHN
SSQRLTLAEVLEHPWIKANSSKPPTGHNSKEATSKSS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctctaggcctgtcaagtccactgttcccttcggt
ccgaaacgagtcttggtgactgagcagattccttctcagcacccaggatcagcgagcagt
ggccaggcccagcgggtcctgtgtccctccaactcccagcgtgtccctccacaagcacag
aaacctgtcgcaggtcagaagccagtgctcaagcagttgccggctgccagcggtcctcga
cctgcttcccggctgagtaacccccagaagagtgagcagccacagcctgcggcctcggga
aataattctgaaaaggaacagacatccatccagaaaactgaagactcaaaaaaaaggcag
tggactttggaagattttgacatcggccgcccactaggaaaagggaagtttggaaatgtc
tacttggcgagggagaagcaaagcaagttcatcctggctctgaaggtgctgtttaaagta
cagctggagaaggcaggtgtggagcaccagctccggagagaagtggagatccagtcccac
ctgcggcaccccaacatcctcaggctgtatgggtatttccatgacgccaccagagtttat
ttaattctggaatacgcgccccttggaacagtatatagagagcttcaaaaactctccaag
tttgatgagcagagaacagctacctacatcacggagttggcgaatgctttgtcctactgc
cactcaaagagagtcatccacagagacatcaagccagagaacctgctgcttggctcaaat
ggggagttgaagatcgcagactttgggtggtctgtgcatgctccgtcttccaggagaacc
acgctgtgtggcaccctggactacctgcccccggagatgattgaaggtcggatgcatgac
gagaaggtggacctctggagcctgggggtgctctgctatgagttcctagtggggatgcct
ccttttgaggcacacacttatcaggagacctacagaaggatatcacgggttgaattcaca
ttccctgactttgtgacggagggagccagggacctcatttcaagactgttaaaacacaac
tcaagtcaaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattct
tcaaaacctccgactggccacaatagcaaagaggcaactagcaaatcgtcttag

DBGET integrated database retrieval system