KEGG   Rattus norvegicus (rat): 261730
Entry
261730            CDS       T01003                                 

Gene name
Aurka
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    261730 (Aurka)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    261730 (Aurka)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    261730 (Aurka)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    261730 (Aurka)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    261730 (Aurka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     261730 (Aurka)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   261730 (Aurka)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     261730 (Aurka)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    261730 (Aurka)
   Spindle formation proteins
    261730 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    261730 (Aurka)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal APH Seadorna_VP7 LBP_C
Other DBs
NCBI-GeneID: 261730
NCBI-ProteinID: NP_695208
RGD: 628895
Ensembl: ENSRNOG00000004479
UniProt: Q3MHU2
Position
3
AA seq 397 aa
MDRCKENCVSRPVKSTVPFGPKRVLVTEQIPSQHPGSASSGQAQRVLCPSNSQRVPPQAQ
KPVAGQKPVLKQLPAASGPRPASRLSNPQKSEQPQPAASGNNSEKEQTSIQKTEDSKKRQ
WTLEDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSH
LRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYC
HSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHD
EKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHN
SSQRLTLAEVLEHPWIKANSSKPPTGHNSKEATSKSS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctctaggcctgtcaagtccactgttcccttcggt
ccgaaacgagtcttggtgactgagcagattccttctcagcacccaggatcagcgagcagt
ggccaggcccagcgggtcctgtgtccctccaactcccagcgtgtccctccacaagcacag
aaacctgtcgcaggtcagaagccagtgctcaagcagttgccggctgccagcggtcctcga
cctgcttcccggctgagtaacccccagaagagtgagcagccacagcctgcggcctcggga
aataattctgaaaaggaacagacatccatccagaaaactgaagactcaaaaaaaaggcag
tggactttggaagattttgacatcggccgcccactaggaaaagggaagtttggaaatgtc
tacttggcgagggagaagcaaagcaagttcatcctggctctgaaggtgctgtttaaagta
cagctggagaaggcaggtgtggagcaccagctccggagagaagtggagatccagtcccac
ctgcggcaccccaacatcctcaggctgtatgggtatttccatgacgccaccagagtttat
ttaattctggaatacgcgccccttggaacagtatatagagagcttcaaaaactctccaag
tttgatgagcagagaacagctacctacatcacggagttggcgaatgctttgtcctactgc
cactcaaagagagtcatccacagagacatcaagccagagaacctgctgcttggctcaaat
ggggagttgaagatcgcagactttgggtggtctgtgcatgctccgtcttccaggagaacc
acgctgtgtggcaccctggactacctgcccccggagatgattgaaggtcggatgcatgac
gagaaggtggacctctggagcctgggggtgctctgctatgagttcctagtggggatgcct
ccttttgaggcacacacttatcaggagacctacagaaggatatcacgggttgaattcaca
ttccctgactttgtgacggagggagccagggacctcatttcaagactgttaaaacacaac
tcaagtcaaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattct
tcaaaacctccgactggccacaatagcaaagaggcaactagcaaatcgtcttag

DBGET integrated database retrieval system