KEGG   Rattus norvegicus (rat): 261738Help
Entry
261738            CDS       T01003                                 

Gene name
Clrn1, Ush3, Ush3a
Definition
(RefSeq) clarin 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MORN PsbN
Motif
Other DBs
NCBI-GeneID: 261738
NCBI-ProteinID: NP_695211
RGD: 628779
Ensembl: ENSRNOG00000042477
UniProt: F1LPA1
Position
2q26
AA seq 232 aa AA seqDB search
MPSQQKKIIFCMAGVLSFLCALGVVTAVGTPLWVKATILCKTGALLVNASGKELDKFMGE
MQYGLFHGEGVRQCGLGARPFRFSFFPDLVQAIPVSIHVNIILFSMILVVLTMVGTAFFM
YNAFGKPFETLHGPLGLYLVSFISGSCGCLVMILFASEVKIHRLSEKIANFKEGTYAYKT
QNENYTTSFWVVFICFFVHFLNGLLIRLAGFQFPFTKSKETETTNVASDLMY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccagcagaagaagatcatcttttgcatggctggcgtattgagctttctctgt
gctctcggagtggtgaccgcagtgggaaccccactgtgggtgaaagccactatcctctgc
aaaacaggggctctgcttgtcaatgcgtcagggaaggagctggacaagttcatgggcgag
atgcagtatggtcttttccacggagaaggcgtaaggcaatgcgggttaggagcaaggcct
ttccggttctcattcttcccagatttggttcaagccatccctgtaagcatccacgtcaat
attattctcttctccatgattcttgtcgtcttaaccatggtggggacagccttcttcatg
tacaatgcttttggcaagccctttgaaactctgcatggaccactggggctctatctggtc
agcttcatttcaggatcctgtggctgtcttgtcatgatactgtttgcctctgaagtgaaa
atccaccgcctttcagagaaaattgcaaattttaaagaagggacctatgcctacaaaacg
caaaacgaaaactataccacctcattctgggttgttttcatttgcttttttgttcatttt
ttgaatgggctcctgatacgacttgctggatttcagttccctttcacaaaatctaaagaa
acagagaccactaacgtagcttcagatttaatgtactga

DBGET integrated database retrieval system