KEGG   Rattus norvegicus (rat): 26194
Entry
26194             CDS       T01003                                 

Gene name
ND2
Definition
(RefSeq) NADH dehydrogenase subunit 2
  KO
K03879  NADH-ubiquinone oxidoreductase chain 2 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26194 (ND2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26194 (ND2)
  09159 Environmental adaptation
   04714 Thermogenesis
    26194 (ND2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26194 (ND2)
   05012 Parkinson disease
    26194 (ND2)
   05014 Amyotrophic lateral sclerosis
    26194 (ND2)
   05016 Huntington disease
    26194 (ND2)
   05020 Prion disease
    26194 (ND2)
   05022 Pathways of neurodegeneration - multiple diseases
    26194 (ND2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26194 (ND2)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26194 (ND2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26194 (ND2)
SSDB
Motif
Pfam: Proton_antipo_M NADH_dehy_S2_C
Other DBs
NCBI-GeneID: 26194
NCBI-ProteinID: YP_665630
RGD: 620556
UniProt: P11662 Q8HID0
Position
MT
AA seq 346 aa
MNPITLIIIYFTILMGPVITMSSSNLLLMWVGLEMSLLAIIPLLANKKSPRSTEAATKYF
LTQATASMIILLVIILNYKQSGMWTLQQQTNNMLLNMMLISLAMKLGLAPFHYWLPEVTQ
GIPLHIGLILLTWQKIAPLSILYQFYQLLNPTITTILAISSVFVGAWGGLNQTQTRKIMA
YSSIAHMGWMTAILPYNPNLTLLNLTIYILLTVPMFITLMTNSATTINTLSLAWNKTPMI
LTMTSIILLSLGGLPPLTGFLPKWAIISELLKNNCSTLSTLMAIMALLSLFFYTRLIYSM
SLTMFPTNNNSKMISHHHQNPKHNFILPTLTVLSTLTLPLSSQLIT
NT seq 1039 nt   +upstreamnt  +downstreamnt
ataaacccaatcaccctaatcattatttactttactatcctcatagggcctgtaatcact
atatctagctccaacttactcctaatatgagtaggattggaaataagccttttagctatc
atcccacttctagccaacaaaaaaagcccacgatcaactgaagcagcaacaaaatatttt
ctaacccaagctacagcctcaataattatcctactagtcatcatcctcaactacaaacaa
tcaggaatatgaaccctccaacaacaaaccaataacatactactcaacataatactcatt
tcactagccataaaacttggactagcccccttccactactgactacccgaagtcacccaa
ggaattcccctacacattggattaatcttactaacatgacaaaaaattgctccactatca
attctataccaattttatcaactcctaaacccaactatcaccaccattctcgcaatttca
tcagtctttgttggcgcctgaggaggacttaaccagacccaaacacgaaaaatcatagca
tattcatcaattgcccacataggatgaataacagcaatccttccatacaaccctaactta
accctcctaaacttaacaatttacatcctacttactgttccaatattcatcacactcata
acaaactcagcaacaacaatcaacacactctcactcgcatgaaataaaactcccataatc
ctaaccataacatccatcatcctcctatcactaggaggactcccccctctcacaggattt
ttaccaaaatgagcaattatctccgagcttctaaaaaacaactgctcaaccctatcaaca
ctaatagctatcatagccctattaagcctattcttctatacacgactaatttactctata
tccctcaccatattcccaaccaacaacaactccaaaataatctcccaccaccaccaaaac
ccaaaacataattttatcctcccaaccctcacagtattaagtacccttaccctaccgctt
tcctcccaactaatcacat

DBGET integrated database retrieval system