KEGG   Rattus norvegicus (rat): 26197Help
Entry
26197             CDS       T01003                                 

Gene name
ATP6
Definition
(RefSeq) ATPase subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26197 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    26197 (ATP6)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    26197 (ATP6)
   05012 Parkinson disease
    26197 (ATP6)
   05016 Huntington disease
    26197 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26197 (ATP6)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    26197 (ATP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_A DUF2919
Motif
Other DBs
NCBI-GeneID: 26197
NCBI-ProteinID: YP_665634
RGD: 621239
UniProt: P05504 Q8HIC7
Position
MT
AA seq 226 aa AA seqDB search
MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLI
HTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHK
LKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaacctatttgcctctttcattacccccacaataataggtctaccaattgtt
gtaaccattattatgttcccatcaattctattcccatcatcagaacgcctaatcagcaac
cgactacactcatttcaacactgactaatcaaacttatcatcaaacaaataatgttaatc
cacacaccaaaaggacgaacctgagccctaataattgtatccctaattatatttattggc
tcaaccaaccttctagggcttcttccccatacatttacccctaccactcagctatctata
aacctaagcatagccatccccctatgagcaggagccgtaattctaggcttccgacacaaa
ctaaaaaattctttagcccacttcttaccgcaaggaacccccatctccctaattcccata
ctaattatcatcgaaactatcagcctatttattcaaccgatagcactagcagtacgacta
acagcaaacattacagcaggccatctattaatgcatctaatcggaggagctactctagta
cttatagacatcagcccaccaaccgctacaattacatttattattctacttctacttaca
gtacttgaatttgccgtagccttaattcaagcctatgtattcacccttctagtaagcctg
tacctacatgataacacataa

DBGET integrated database retrieval system