KEGG   Rattus norvegicus (rat): 26201
Entry
26201             CDS       T01003                                 

Gene name
ND4
Definition
(RefSeq) NADH dehydrogenase subunit 4
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26201 (ND4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    26201 (ND4)
  09159 Environmental adaptation
   04714 Thermogenesis
    26201 (ND4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26201 (ND4)
   05012 Parkinson disease
    26201 (ND4)
   05014 Amyotrophic lateral sclerosis
    26201 (ND4)
   05016 Huntington disease
    26201 (ND4)
   05020 Prion disease
    26201 (ND4)
   05022 Pathways of neurodegeneration - multiple diseases
    26201 (ND4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26201 (ND4)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     26201 (ND4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    26201 (ND4)
SSDB
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Other DBs
NCBI-GeneID: 26201
NCBI-ProteinID: YP_665638
RGD: 620559
UniProt: P05508 Q8HIC6
Position
MT
AA seq 459 aa
MLKIIFPSIMLLPLTWLSANKKIWTNVTSYSFLVSLLSLSLLWQNDENYLNFSVMFSSDP
LSTPLIILTTWLLPLMMLASQNHMKKENMMHQKLYISMLISLQILLIMTFSATELILFYI
LFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALISIQNSMGTLNFLILS
LTTHPLPSTWSNTILWLACMMAFMIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGG
YGMMRVSIILDPLTKSLAYPFIILSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVITA
IMIQTPWSFMGATMLMIAHGLTSSLLFCLANTNYERIHSRTMIMARGLQMIFPLMATWWL
LASLANLALPPLINLMGELFIVMATFSWSNPSIILMATNIVITGIYSMYMIITTQRGKLT
SHMNNLQPSHTRELTLMALHIIPLMLLTINPKLITGLTM
NT seq 1378 nt   +upstreamnt  +downstreamnt
atgttaaaaattattttcccatctatcatactcctcccactaacatgactctcagccaac
aaaaaaatctgaaccaatgtcacctcctacagctttctagtgagcctattaagcttatca
ctcctatgacaaaatgacgaaaattacctaaatttctcagttatattctcctccgatcca
ttatccaccccactaatcattctaacaacttgactcctcccactaataatgctcgctagc
caaaatcacataaaaaaagaaaatataatgcatcaaaaactttacatctcaatacttatt
agcctccaaattttactcatcataacattctccgcaacagaactaattttattttatatc
ctgttcgaagccactctaatcccaacactaattatcattacacgatgaggcaaccaaaca
gaacgcttaaatgcaggaatttatttcctattttatacactaattggctccatcccactc
ttaattgccctcatttcaatccaaaactcaataggaacactcaacttcctaatcctctcc
ctcacaacacaccccctaccctcaacatgatccaacaccattctatgactagcatgtata
atagcatttataatcaaaataccattatacggagtccatctatgattaccaaaagcccac
gtagaagctccaattgcaggctctataattttagcagcaattctcctaaagctagggggt
tatgggataatacgagtttccatcattctagaccccctaacaaaatctttagcctaccca
ttcatcatcctctcattatgaggcataattataactagctcaatctgcctacgccaaaca
gatctaaaatcattaattgcttactcatcagtaagccatatagccctagtcatcacagcc
attataatccagacaccatgaagcttcatgggagctacaatactaataatcgcccacggc
ttaacctcctcactcttattctgcctagcaaacaccaactacgaacgaattcacagccga
actataattatagctcgaggattacaaataatctttccattgatagcaacatgatgacta
ttagcaagcttagccaacctagcactaccacccctaattaacctcataggcgagttattc
attgttatagcaacattttcctgatcgaacccctctatcatccttatagcaactaacatt
gtcatcacaggaatctactcaatatatataattatcacaacccaacgaggaaaactaacc
agccacataaacaacctccaaccttcccacacacgagaattaacactcatagctctacac
attattcccctcatactattaacaatcaaccctaaactcatcacaggcctaacaatat

DBGET integrated database retrieval system