KEGG   Rattus norvegicus (rat): 266601Help
Entry
266601            CDS       T01003                                 

Gene name
Tomm20
Definition
(RefSeq) translocase of outer mitochondrial membrane 20
  KO
K17770  mitochondrial import receptor subunit TOM20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    266601 (Tomm20)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    266601 (Tomm20)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    266601 (Tomm20)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   266601 (Tomm20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAS20 TPR_1 RSN1_7TM TPR_2 TPR_14
Motif
Other DBs
NCBI-GeneID: 266601
NCBI-ProteinID: NP_690918
RGD: 708467
Ensembl: ENSRNOG00000019980
UniProt: Q62760
Structure
PDB: 

Position
19q12
AA seq 145 aa AA seqDB search
MVGRNSAIAAGLCGALFIGYCIYFDRKRRGDPNFKNRLRERRKKQKLAKERAGLSKLPDL
KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQ
MLLTKLPTISQRIVSAQSLAEDDVE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggtgggccggaacagcgccatcgccgcggggctgtgcggtgccctcttcatagggtac
tgcatctactttgaccgcaaaaggcgaggtgaccccaacttcaagaacaggcttcgagaa
cgaagaaagaaacagaagcttgctaaggagagagctgggctttccaagttacctgattta
aaagatgctgaagctgttcagaaattcttccttgaagagatacagcttggtgaagagtta
ttagcacaaggtgactatgagaagggtgtggaccacctgacaaatgcaatcgctgtgtgt
ggacagcctcagcagttgctgcaagtgttacaacagactcttccaccaccagtgttccag
atgcttctgaccaagcttccaaccattagtcagagaattgtcagtgctcagagcttggct
gaggatgatgtggaatga

DBGET integrated database retrieval system