KEGG   Rattus norvegicus (rat): 266604
Entry
266604            CDS       T01003                                 

Gene name
Alox15b
Definition
(RefSeq) polyunsaturated fatty acid lipoxygenase ALOX15B
  KO
K08022  arachidonate 15-lipoxygenase (second type) / 8-lipoxygenase (S-type) [EC:1.13.11.33 1.13.11.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    266604 (Alox15b)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    266604 (Alox15b)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     266604 (Alox15b)
    1.13.11.-  
     266604 (Alox15b)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 266604
NCBI-ProteinID: NP_695213
RGD: 628809
Ensembl: ENSRNOG00000007778
UniProt: Q8K4F2
Position
10
AA seq 677 aa
MAKFRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQD
VGTVLMLRIHKAPPEAPLPLLSFPPDAWYCRWFELEWLPGAALRFPCYQWLEGAGELVLR
EGAAKVSWQDHHRTLQDQRQKELESRKDMYSWKTYIEGWPHCLDHETVKDLDLNIKYSAM
KNAKFFFKAQSAFTELKFKGLLDRTGLWRSLREMKRMFNFHNTPAAEYVFAHWQEDAFFA
SQFLNGLNPVLIRRCRRLPENFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVQ
TNVINGKPQFSAAPMTLLYQSPGSGPLLPIAIQLKQTPGPDNPIFLPSDDKWDWLLAKTW
VRNAEFSIHEALTHLLHAHLIPEVFALATLRQLPHCHPLFKLLIPHTRYTLHINTLAREL
LIAPGKVVDKSTGLGIGGFSDLIKRNMEQLSYSVLCLPEDIRARDVGDLPGYYYRDDGMQ
IWSAIRSFVSEIVDIYYPSDASVRDDQELQAWVGEIFSEGFLSQESSGMPSLLDTQEALV
QYVTMVIFTCSAKHAAVSASQFDSCVWMPNLPPSMQLPPPTSKGQASPEGFIATLPAVNA
TCDVIIALWLLSKEPGDRRPLGHYPDEHFTEEVPRRSIAAFQRKLIQISSGIRKRNQSLA
LPYTYLDPPLIENSVSI
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggctaaattcagggtgagagtatccaccggggaggcctgtggggcaggcacatgggac
aaagtgtctgtcagcatcgtgggaacccatggagagagccccttagtacctctggaccat
ctgggcaaggagttcagcgctggagctgaagaagacttcgaggtgacgcttccccaggac
gttggcactgtgctgatgctgcgaatacacaaggcacccccggaggcacccctcccactt
ctgtctttcccacctgatgcctggtactgccgctggtttgagctggagtggctgccgggg
gctgcacttcgcttcccctgttatcagtggctggaaggggcaggggagctggtgctgaga
gagggagcagccaaggtgtcctggcaagaccaccaccgtacgctgcaggatcagcgccag
aaggagctggagtccaggaaggacatgtacagctggaagacttacattgaaggttggcct
cactgccttgaccatgagaccgtgaaagacttggacctcaacatcaagtactctgcaatg
aagaacgccaaattcttctttaaagcccagtctgcgtttacagagctgaaattcaaaggg
ctcctggaccgcacaggactctggaggagtctgagggagatgaaaaggatgtttaacttc
cacaacactccagcagcagagtatgtgtttgcacactggcaggaagatgccttcttcgcc
tcccagttcctaaatggcctcaacccagttctgattcgccgctgtcgcagactcccagag
aacttcccagtcactgatgaaatggtggctccagtgctgggccctgggaccagtctgcag
gctgagttagagaagggctccctgttcttggtggaccatggaattctttctggagtgcaa
accaatgtcatcaatggaaagcctcagttctcagcagccccgatgaccctattataccag
agtccagggtccggacccctgcttcccatcgccatacagctcaaacagactcccgggcca
gacaaccccatcttcctgcccagcgatgacaagtgggactggctactggccaagacctgg
gtgcgcaacgctgagttttccatccacgaggctctcacgcatctgctgcatgcccacctg
attccagaagtctttgccttggccacactgcgccagctgccccactgtcaccctctcttc
aagctgctgattcctcacactcggtacacactgcacatcaacacactcgcccgtgagctg
ctcattgcccctgggaaggtggtggacaagtccacaggccttggcattgggggattctct
gacctgataaagagaaacatggagcagctgagctattctgtcctgtgtctccctgaagat
atccgagcccgagatgtgggagacctcccaggatactattaccgagatgatgggatgcag
atctggagtgcaataaggagcttcgtctctgagatagttgacatctattacccaagtgac
gcatctgtccgagatgaccaagagctccaggcctgggtgggggagatcttctctgagggc
ttcctcagccaagaaagctcaggtatgccctccttgttggatacccaggaagccctggtc
caatatgttaccatggtgatattcacctgctcagccaagcatgcagctgtcagtgcaagc
cagtttgactcgtgtgtttggatgcccaatctgccaccttccatgcagctaccaccacct
acttccaaaggccaggcaagccctgagggtttcatagccacactcccagcagtcaatgcc
acatgtgatgtcatcatcgccctctggctgctaagcaaggagccaggggaccgtaggccc
ctgggccactatccagatgagcacttcacagaggaggtcccacggcggagcatcgcggcc
ttccagagaaagctgatccagatatccagtggcatcaggaagaggaaccaaagcctggca
ctgccctacacctacctggatcctcccctcatcgagaacagtgtctccatctaa

DBGET integrated database retrieval system