KEGG   Rattus norvegicus (rat): 266607Help
Entry
266607            CDS       T01003                                 

Gene name
Ffar1, Gpr40
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    266607 (Ffar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    266607 (Ffar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    266607 (Ffar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Cytochrome_B
Motif
Other DBs
NCBI-GeneID: 266607
NCBI-ProteinID: NP_695216
RGD: 628613
Ensembl: ENSRNOG00000024009
UniProt: Q8K3T4
Position
1q21
AA seq 300 aa AA seqDB search
MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccccacagctctccttcgctctctatgtatcagcctttgcactaggcttt
ccattgaacttgttagccatccgaggtgcagtgtcccacgcgaaactgcgactcaccccc
agcttggtctacactctccatttggcctgctctgacctcctactggccatcaccctgccc
ctgaaggctgtggaggccctggcttctggggtctggcccctgccactccccttctgccca
gtctttgccttggcccactttgcgcccctctatgcaggtggaggcttcctggctgctctc
agtgctggccgctacctgggagctgccttcccctttggataccaagccatccggaggccc
tgctattcctggggtgtgtgtgtggctatatgggcccttgtcctttgccacctgggactg
gctcttggcttggaggctcccagaggctgggtggataacaccaccagttccctgggcatc
aacatacccgtgaatggctccccggtctgcctggaagcgtgggatcctgactctgcccgc
cctgcccgactcagtttctcgattctgctcttctttctgcccttggttatcactgctttc
tgctatgtgggctgcctccgggccctggtgcactcgggcctgagccacaaacggaagctc
agggcagcttgggtggctggaggagcacttctcacactcctgctctgcctggggccctat
aatgcttccaatgtggctagtttcataaacccggacttagaaggctcctggaggaagttg
gggctcatcacaggagcctggagtgtggtgctcaacccactggtcactggctacttggga
acaggtcctggacaggggacaatatgtgtgaccaggactccaagagggacaattcagaag
tag

DBGET integrated database retrieval system