KEGG   Rattus norvegicus (rat): 266610Help
Entry
266610            CDS       T01003                                 

Gene name
Fadd, Mort1
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05010  Alzheimer disease
rno05142  Chagas disease (American trypanosomiasis)
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    266610 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    266610 (Fadd)
   04215 Apoptosis - multiple species
    266610 (Fadd)
   04217 Necroptosis
    266610 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    266610 (Fadd)
   04621 NOD-like receptor signaling pathway
    266610 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    266610 (Fadd)
   04657 IL-17 signaling pathway
    266610 (Fadd)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    266610 (Fadd)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    266610 (Fadd)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    266610 (Fadd)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    266610 (Fadd)
   05161 Hepatitis B
    266610 (Fadd)
   05160 Hepatitis C
    266610 (Fadd)
   05168 Herpes simplex infection
    266610 (Fadd)
   05163 Human cytomegalovirus infection
    266610 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    266610 (Fadd)
   05169 Epstein-Barr virus infection
    266610 (Fadd)
   05165 Human papillomavirus infection
    266610 (Fadd)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    266610 (Fadd)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    266610 (Fadd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death DED
Motif
Other DBs
NCBI-GeneID: 266610
NCBI-ProteinID: NP_690920
RGD: 628700
Ensembl: ENSRNOG00000047035
Vega: OTTRNOG00000002446
UniProt: Q8R2E7
Position
1q42
AA seq 208 aa AA seqDB search
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHT
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccagcagcctgtcgggcaacgatctg
acggatctcaagttcctgtgccgcgagcgcgtgagtaaacgaaagctggagcgcgtgcag
agtggcctggacctgttctcggtgctgctggagcagaacgatctggagcgcgggcacacc
gggctgctgcgcgagttgctggcctcgctgggcagacacgacctactgcagcgcctggac
gacttcgaggcgggggcgacgactgctgcaaccccgggggaggcagatctgcgggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgtgagctgaag
gtgtctgaggccaagattgatggcattgaggagaggtacccccgaagcctgagtgatcgg
gtaagggagactctgcgagtctggaagaatgtcgagaaggagaacgcctcggtggctgga
ctggtcaaggcactgcgggcctgccggctgaacctggtggctgacctggtggaagaagca
ttgatggcccagggatctgtgagcaagagtgatgatacatcctcagcgctgagggattca
actgtgtctttctcagaaacaccctga

DBGET integrated database retrieval system