KEGG   Rattus norvegicus (rat): 266610Help
Entry
266610            CDS       T01003                                 

Gene name
Fadd, Mort1
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05010  Alzheimer disease
rno05142  Chagas disease (American trypanosomiasis)
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    266610 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    266610 (Fadd)
   04215 Apoptosis - multiple species
    266610 (Fadd)
   04217 Necroptosis
    266610 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    266610 (Fadd)
   04621 NOD-like receptor signaling pathway
    266610 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    266610 (Fadd)
   04657 IL-17 signaling pathway
    266610 (Fadd)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    266610 (Fadd)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    266610 (Fadd)
  09167 Infectious diseases
   05152 Tuberculosis
    266610 (Fadd)
   05161 Hepatitis B
    266610 (Fadd)
   05168 Herpes simplex infection
    266610 (Fadd)
   05163 Human cytomegalovirus infection
    266610 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    266610 (Fadd)
   05165 Human papillomavirus infection
    266610 (Fadd)
   05142 Chagas disease (American trypanosomiasis)
    266610 (Fadd)
  09168 Drug resistance
   01524 Platinum drug resistance
    266610 (Fadd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death DED
Motif
Other DBs
NCBI-GeneID: 266610
NCBI-ProteinID: NP_690920
RGD: 628700
Ensembl: ENSRNOG00000047035
Vega: OTTRNOG00000002446
UniProt: Q8R2E7
Position
1q42
AA seq 208 aa AA seqDB search
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHT
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccagcagcctgtcgggcaacgatctg
acggatctcaagttcctgtgccgcgagcgcgtgagtaaacgaaagctggagcgcgtgcag
agtggcctggacctgttctcggtgctgctggagcagaacgatctggagcgcgggcacacc
gggctgctgcgcgagttgctggcctcgctgggcagacacgacctactgcagcgcctggac
gacttcgaggcgggggcgacgactgctgcaaccccgggggaggcagatctgcgggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgtgagctgaag
gtgtctgaggccaagattgatggcattgaggagaggtacccccgaagcctgagtgatcgg
gtaagggagactctgcgagtctggaagaatgtcgagaaggagaacgcctcggtggctgga
ctggtcaaggcactgcgggcctgccggctgaacctggtggctgacctggtggaagaagca
ttgatggcccagggatctgtgagcaagagtgatgatacatcctcagcgctgagggattca
actgtgtctttctcagaaacaccctga

DBGET integrated database retrieval system