KEGG   Rattus norvegicus (rat): 266610
Entry
266610            CDS       T01003                                 

Gene name
Fadd
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05142  Chagas disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    266610 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    266610 (Fadd)
   04215 Apoptosis - multiple species
    266610 (Fadd)
   04217 Necroptosis
    266610 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    266610 (Fadd)
   04621 NOD-like receptor signaling pathway
    266610 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    266610 (Fadd)
   04657 IL-17 signaling pathway
    266610 (Fadd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    266610 (Fadd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    266610 (Fadd)
   05161 Hepatitis B
    266610 (Fadd)
   05160 Hepatitis C
    266610 (Fadd)
   05164 Influenza A
    266610 (Fadd)
   05162 Measles
    266610 (Fadd)
   05168 Herpes simplex virus 1 infection
    266610 (Fadd)
   05163 Human cytomegalovirus infection
    266610 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    266610 (Fadd)
   05169 Epstein-Barr virus infection
    266610 (Fadd)
   05165 Human papillomavirus infection
    266610 (Fadd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    266610 (Fadd)
   05152 Tuberculosis
    266610 (Fadd)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    266610 (Fadd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    266610 (Fadd)
   05022 Pathways of neurodegeneration - multiple diseases
    266610 (Fadd)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    266610 (Fadd)
SSDB
Motif
Pfam: DED Death
Other DBs
NCBI-GeneID: 266610
NCBI-ProteinID: NP_690920
RGD: 628700
Ensembl: ENSRNOG00000047035
Vega: OTTRNOG00000002446
UniProt: Q8R2E7
Position
1
AA seq 208 aa
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHT
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
NT seq 627 nt   +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccagcagcctgtcgggcaacgatctg
acggatctcaagttcctgtgccgcgagcgcgtgagtaaacgaaagctggagcgcgtgcag
agtggcctggacctgttctcggtgctgctggagcagaacgatctggagcgcgggcacacc
gggctgctgcgcgagttgctggcctcgctgggcagacacgacctactgcagcgcctggac
gacttcgaggcgggggcgacgactgctgcaaccccgggggaggcagatctgcgggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgtgagctgaag
gtgtctgaggccaagattgatggcattgaggagaggtacccccgaagcctgagtgatcgg
gtaagggagactctgcgagtctggaagaatgtcgagaaggagaacgcctcggtggctgga
ctggtcaaggcactgcgggcctgccggctgaacctggtggctgacctggtggaagaagca
ttgatggcccagggatctgtgagcaagagtgatgatacatcctcagcgctgagggattca
actgtgtctttctcagaaacaccctga

DBGET integrated database retrieval system