KEGG   Rattus norvegicus (rat): 266631
Entry
266631            CDS       T01003                                 

Gene name
Rbm45, Drb1
Definition
(RefSeq) RNA binding motif protein 45
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_5 RRM_3 RNA_bind RRM_occluded
Other DBs
NCBI-GeneID: 266631
NCBI-ProteinID: NP_695218
RGD: 628862
Ensembl: ENSRNOG00000010595
UniProt: Q8CFD1
Position
3q24
AA seq 476 aa
MDDAGSSGGSGGFRPGVDSLDEPPNSRIFLVISKYTSESVLREHFSPFGDIQDIWVVRDK
HTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEEL
TRIFVMIPKSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQAIEN
CDRSFRALLAEPKNKVLESPEQDYYSSVRQETLGHEPRGNLFPFVGEQQSEFSTFDKNDS
RGQEAISKRLSVASRVPFTEEQLFSIFDIVPGLEYCEVHRDPYLNYGHGVVQYFNVASAV
YAQYKLHGFQYPPGNRIAVSFLDDGSNSADLIRKMATQMVAAQLASTVWSNPSHQQFLQF
GGSAGSQVPQIQTDVVLPSCRKKAPPETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIE
VYLVSGKNVGYVKYADRMSANDAITTLHGKILNGVRLKVMLADSPREVSKKRQRTY
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggacgacgccggcagctccggaggcagcggaggcttccgccccggagtagacagtctg
gatgagccgcccaacagccgcatcttcctagtgatcagcaagtacacatcggaatcggtg
ctgagggagcacttctcgcccttcggagacatccaggacatctgggtagtgcgcgacaag
cacactaaggagtccaagggcatcgccttcgtcaagttcgcacgcagctcacaggcctgc
cgggctatggaggagatgcacggacagtgccttggtcccaacgacaccaagcccatcaag
gttttcattgcccagtcccgatcatcagggagtcacagggatgtcgaagacgaagagctc
acgaggatctttgtcatgataccaaagtcctacacggaggaagacctgcgggagaagttc
aaggtgtatggagacatcgagtactgcagcgttattaagaataaagtcactggagaaagt
aaaggcttgggctacgtgcggtacttaaaaccatcacaagctgcccaggcaatagaaaac
tgtgatagaagtttcagagcactcttggctgaacctaaaaataaagtgttggagtcccca
gaacaagattattacagtagcgtgaggcaggagactttggggcacgagcctagaggaaat
ctgtttcccttcgttggagaacaacaatctgaattttcaacttttgacaagaacgatagc
agaggccaggaagctatctccaaacgcctgtcggtggcgtcgagggtccccttcacagag
gagcagctcttcagcatttttgacatcgtcccagggctggagtactgtgaggttcaccga
gacccttacttaaattatggtcatggcgtggttcagtattttaacgtggcatcggctgtt
tatgcacaatacaaactgcatggattccagtaccctcccgggaatcggatagctgtttcc
tttctggatgacggaagtaattcagctgatctcatcaggaaaatggccacacagatggtg
gcggcacagctcgcgtcaacggtgtggagtaacccgagtcaccagcagtttctgcaattc
ggaggaagtgctgggtcacaagtgcctcaaatccagacagacgtagtacttccgtcatgc
agaaagaaagccccaccggaaactcctgtgaaagaaaggctgtttattgtgtttaatccc
catcctttgccgttagacgtgttggaggatatattctgccgttttgggaacctgattgag
gtctaccttgtgtcggggaaaaatgtgggctatgtcaagtatgctgatagaatgagcgcc
aatgacgccatcacaactctgcacgggaagattctaaatggggtcagacttaaggttatg
ctggcagattccccaagagaagtatccaaaaagaggcagagaacttactga

DBGET integrated database retrieval system