KEGG   Rattus norvegicus (rat): 266684Help
Entry
266684            CDS       T01003                                 

Gene name
Cyp2d1, Cyp2d9
Definition
(RefSeq) cytochrome P450, family 2, subfamily d, polypeptide 1
  KO
K07414  cytochrome P450 family 2 subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    266684 (Cyp2d1)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    266684 (Cyp2d1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     266684 (Cyp2d1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   266684 (Cyp2d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 266684
NCBI-ProteinID: NP_695225
RGD: 708427
Ensembl: ENSRNOG00000029179
UniProt: P10633 A0A0G2JSU8
Position
7q34
AA seq 504 aa AA seqDB search
MELLNGTGLWSMAIFTVIFILLVDLMHRRHRWTSRYPPGPVPWPVLGNLLQVDLSNMPYS
LYKLQHRYGDVFSLQKGWKPMVIVNRLKAVQEVLVTHGEDTADRPPVPIFKCLGVKPRSQ
GVILASYGPEWREQRRFSVSTLRTFGMGKKSLEEWVTKEAGHLCDAFTAQAGQSINPKAM
LNKALCNVIASLIFARRFEYEDPYLIRMVKLVEESLTEVSGFIPEVLNTFPALLRIPGLA
DKVFQGQKTFMALLDNLLAENRTTWDPAQPPRNLTDAFLAEVEKAKGNPESSFNDENLRM
VVVDLFTAGMVTTATTLTWALLLMILYPDVQRRVQQEIDEVIGQVRCPEMTDQAHMPYTN
AVIHEVQRFGDIAPLNLPRITSCDIEVQDFVIPKGTTLIINLSSVLKDETVWEKPHRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPVGQPRPST
HGFFAFPVAPLPYQLCAVVREQGL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgaatgggactggcctgtggtccatggccatattcacagtcatcttcata
ttactggtggacctgatgcaccggcgccatcgctggacttctcgctaccctccaggccct
gtgccgtggcctgtgctgggcaacctgctgcaggtggacctcagtaacatgccatacagc
ctctacaagcttcaacaccgctatggtgacgtgttcagcctgcagaagggttggaagccc
atggtcattgtcaacagactgaaagcggtgcaggaagtgctggtgactcatggagaggac
actgctgaccgccctccagtgcccatctttaagtgcctgggtgtgaagcccagatcccaa
ggtgtgatccttgcatcttacgggcctgagtggcgagagcagaggcgattctctgtgtcc
accctgcgcaccttcggcatgggcaagaaatccctggaggagtgggtgaccaaggaggcc
ggccacctctgtgatgccttcactgcccaggctgggcagtccatcaatcccaaggccatg
ctgaacaaagccttgtgtaatgtgatcgcatccctcatttttgcccgtcgctttgaatat
gaagacccttacctcatcaggatggtgaaactagtggaagagagtttgacagaagtctct
ggtttcattcctgaggttcttaacacgttcccagcactgctgcgcatcccagggctggct
gacaaggtcttccaaggtcagaagaccttcatggccttactggataacctgctggctgag
aacaggaccacctgggaccctgcccagccaccccgaaatctgactgatgccttcctggct
gaggtggagaaggccaaggggaatcctgagagcagctttaatgatgagaacctacgcatg
gtggtagttgacctgttcactgcagggatggtgaccaccgccaccacactgacctgggcc
ctactgctcatgattctatacccggatgtgcagcgcagagtccaacaagagattgatgag
gtcatagggcaggtgcggtgtccagagatgacagaccaggcccacatgccctacaccaat
gctgtcatccatgaggtacagcgctttggggacattgctccattgaatttgccacgcatc
acgagttgtgacattgaagtgcaggacttcgtcatccccaaggggacgaccctcatcatc
aacctgtcgtccgtgctgaaggatgagaccgtctgggagaagccccaccgcttccatcca
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgccttggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctccgtgcccgtcggacagccccggcccagcacc
catggcttctttgcttttccagttgcccccttgccctaccagctctgtgctgtggtacgg
gagcaaggactctaa

DBGET integrated database retrieval system