KEGG   Rattus norvegicus (rat): 266685Help
Entry
266685            CDS       T01003                                 

Gene name
Ugt2b17, Rlug38, UDPGT_2B5, Udpgt, Udpgtr-3, Ugt2b3, Ugt2b5
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B15
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    266685 (Ugt2b17)
   00053 Ascorbate and aldarate metabolism
    266685 (Ugt2b17)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    266685 (Ugt2b17)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    266685 (Ugt2b17)
   00860 Porphyrin and chlorophyll metabolism
    266685 (Ugt2b17)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    266685 (Ugt2b17)
   00982 Drug metabolism - cytochrome P450
    266685 (Ugt2b17)
   00983 Drug metabolism - other enzymes
    266685 (Ugt2b17)
 09160 Human Diseases
  09161 Cancers
   05204 Chemical carcinogenesis
    266685 (Ugt2b17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    266685 (Ugt2b17)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     266685 (Ugt2b17)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   266685 (Ugt2b17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 266685
NCBI-ProteinID: NP_695226
RGD: 628623
Ensembl: ENSRNOG00000046540
UniProt: P08542
Position
14p21
AA seq 530 aa AA seqDB search
MPGKWISALLLLQISCCFQSGNCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSA
YYVLDPKKSPDLKFETFPTSVSKDELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGF
SDYYLSLCKDTVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYK
IEKSSGRFILPPSYVPVILSGMGGPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEI
LGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSS
GEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDLLGHPKTKAFVTHSGANGVYEAIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRT
MSKSDLFNALKEIINNPFYKKNAVWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPL
GHDLPWYQYHSLDVIGFLLTCSAVIAVLTVKCFLFIYRLFVKKEKKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagtggatttctgctcttctcctgctacagataagttgctgtttccaatct
gggaactgtgggaaggtgttggtgtggccgatggaattcagccactggatgaatataaaa
acaatactggatgaacttgtacagaggggccatgaagtcactgttctgaaaccttcggct
tactatgttcttgatccgaaaaaatcgccagatcttaagtttgaaactttccctacatct
gtcagtaaagatgaactggaaaattatttcataaagcttgtggatgtgtggacttatgag
ttgcaaagagatacatgtttgtcttattctcctttactacaaaatatgatagatggattt
tctgattactatctaagtctttgtaaagacaccgtttcaaacaagcagctcatggcaaaa
ctacaggaatccaagtttgatgttcttttgtcagatcctgtggctgcctgtggggagctg
atagccgaagtgctccacattccttttctgtacagtcttcgcttctctccaggctacaaa
attgaaaagtccagtggaagatttatattacctccatcttatgtaccagtaattttgtca
ggaatgggtggcccaatgacattcatagacagggtaaaaaatatgatatgtacgctttat
tttgacttttggttccatatgtttaatgccaagaaatgggatccattttacagtgagatt
ttgggaaggcccaccaccttagctgagacaatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggaatttccccacccaacattaccaaatgttgactatattggagga
ctccaatgcagacctcctaaacccttgcccaaggatatggaagattttgtccagagctct
ggagagcatggcgtggtggtgttttctctggggtcaatggtcagcagcatgacagaagaa
aaggccaatgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaaccttaggacccaataccagagtctacaagtggcttccccag
aatgacctccttggtcatccaaaaaccaaagcctttgtaactcatagtggagccaatggt
gtctatgaggccatctatcatggaatccctatggttggcattcctatgtttggagaacaa
catgataacattgcccacatggtggccaaaggagcagctgttacactgaatatcaggaca
atgtcaaagtcagatttgttcaatgcactaaaggaaataataaacaatccattctataaa
aaaaatgctgtgtggttgtcaaccattcaccatgaccaacctatgaagcccctggacaag
gctgtcttctggattgagtttgtcatgcgccacaaaggggccaagcacctgaggccactt
ggacatgaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgttcggcagtcattgcagtccttactgtaaaatgcttcttgtttatttaccgactcttt
gtgaagaaggaaaagaaaatgaagaatgagtag

DBGET integrated database retrieval system