KEGG   Rattus norvegicus (rat): 266687Help
Entry
266687            CDS       T01003                                 

Gene name
Slc35e4
Definition
(RefSeq) solute carrier family 35, member E4
  KO
K15286  solute carrier family 35, member E4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    266687 (Slc35e4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   266687 (Slc35e4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPT EamA UAA Mg_trans_NIPA
Motif
Other DBs
NCBI-GeneID: 266687
NCBI-ProteinID: NP_695228
RGD: 708484
Ensembl: ENSRNOG00000004168
UniProt: Q5RKL7
Position
14q21
AA seq 350 aa AA seqDB search
MCRCPLEHHEVRMTSAEAIAVAGSAQEHGRPKWPPDKPQVLGQPALARVVVAALVWLLAG
ASMSSLNKWIFTVHGFGRPLLLSALHMLAAAVACHWGAQRPVPHSIHRRVLLLSLTFGTS
MACGNVGLSTVPLDLAQLATTTTPLFTLALSALLLGRRHHPLQFAAMGPLCLGAACSLAG
ELRAPPAGCGFLLVATCLRGFKSVQQSALLQEERLDAVTLLYATSLPSFCLLAGAALVLE
AGAAPPLPPTDSRLWACVLLSCFLSVVYNLASFSLLALTSALTVHVLGNLTVVGNLILSR
LLFGSHLSALSYVGIALTLSGMFLYHNCESVASWATRRGLWNRDQPGKGL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgctgcccactggagcaccatgaagtcaggatgacctcagccgaagcaattgct
gtggctggaagtgcccaggagcatggccgtcccaagtggcctcctgacaaacctcaagtc
cttgggcagcctgctctggcgagagtggttgtggcagcactggtgtggctgttggcagga
gccagcatgtcaagtctcaacaagtggatcttcacagtgcatggcttcggacggcccctg
ttattgtcagccctgcacatgctggcagccgctgtggcatgccactggggggcccagcga
cccgtgccccatagcatccaccgcagggtgctgttactcagcctcaccttcgggacctcc
atggcgtgtggcaacgtgggcctgagcactgtccccttggacctagcacagctagccacc
accaccacaccactgttcactttggccttgtctgcgttgctgcttggccgaagacaccat
cccctgcagtttgctgccatgggtccgctctgcctaggggctgcatgcagtctggctgga
gagctccgggcacctcctgctggttgtggcttcttgctggtggccacctgtctccgaggt
ttcaagtctgttcaacagagtgctctgctgcaggaagagaggctagatgcggtgactctg
ctgtacgccacttctttgcccagtttctgcctgctggcaggcgccgcgctggtgctggag
gctggtgccgccccaccgctgcctcccaccgactctcgcctctgggcctgcgtcctgctc
agctgcttcttgtctgtagtctacaacctggccagcttctccttgctggcactcacatct
gccctcaccgtccacgtactgggcaacctcacagttgtgggtaacctcatcctgtcccgg
ctcctgttcggcagccacctcagcgctctcagctatgtgggcatcgctctcaccctttca
ggaatgtttctttatcacaactgtgagtctgtggcctcctgggctacccgccgggggttg
tggaacagggaccagcctggcaaaggtctttga

DBGET integrated database retrieval system