KEGG   Rattus norvegicus (rat): 266705Help
Entry
266705            CDS       T01003                                 

Gene name
Ppp1r17, Gsbs
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 17
  KO
K08067  protein phosphatase 1 regulatory subunit 17
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    266705 (Ppp1r17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    266705 (Ppp1r17)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     266705 (Ppp1r17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 266705
NCBI-ProteinID: NP_703197
RGD: 628647
Ensembl: ENSRNOG00000012235
UniProt: Q8CJC8
Position
4q24
AA seq 159 aa AA seqDB search
MSTEMMTTEPVQSLELSEDILDKLDPHGSHSDDLSDQFIKDCDLKKKPRKGKNVQATLNV
ESDQKKPRRKDTPALHIPPFIPGVISEHLIKRYDVQERIPKGKTGPALHNTDVEQKRPRR
KDTPAFHVPPFVAGLTLLEDEGTGVIMEDEEMDGDKLAI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgagatgatgaccactgagccagtgcagtctctggagctttcagaagacata
ctagacaagctcgatcctcatggcagccactcagatgacctttcagaccagttcattaag
gactgtgacctgaaaaagaagccaagaaaggggaagaatgtacaggccactctgaacgtt
gagtccgatcaaaagaaacccagaaggaaagatacgccagcattgcacatcccacctttc
ataccaggtgtgatttcagaacacttaattaaaagatatgacgttcaagagagaattcca
aagggcaaaacaggtccagctcttcataacactgatgtggaacagaaaaggccaaggaga
aaagacacacctgccttccatgtgcctccctttgttgcaggtttgactctcctcgaggat
gagggcaccggagtgattatggaggatgaagaaatggatggtgacaagctagctatttaa

DBGET integrated database retrieval system